Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V6DI14

Protein Details
Accession A0A4V6DI14    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
275-295SEPAPKKVKAAPKGRKKAAAAHydrophilic
NLS Segment(s)
PositionSequence
145-200PAKGKKRGRKPAAAAADEDEEEEKPKAKRAKKATVKPEPEDEDEKPKPKARRDKAA
225-252PKPKRGSAKKAAVPKKPAAKKPATKKAK
279-312PKKVKAAPKGRKKAAAAPAAEEKPKSARASRSRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001510  Znf_PARP  
IPR036957  Znf_PARP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00645  zf-PARP  
Amino Acid Sequences MPEYRIEVSPNNRAGCSDGVCKKAAVKCVKGSLRFGTWTKIMDHEAIKWKHWGCVSGEQMAQVRGLCEKADGTFDFDAFDGYDEMNDHPDLQAKIRKAVEQGHIDSDDFNGDPWMNKTGQRGIRGKKPKDWDDGEDADKVEEEAPAKGKKRGRKPAAAAADEDEEEEKPKAKRAKKATVKPEPEDEDEKPKPKARRDKAAAAAAAAAVKAEDKDSEEEEEEENAPKPKRGSAKKAAVPKKPAAKKPATKKAKAVVNDEEDSEADIVTASEDDEESEPAPKKVKAAPKGRKKAAAAPAAEEKPKSARASRSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.34
4 0.34
5 0.33
6 0.34
7 0.35
8 0.35
9 0.38
10 0.39
11 0.44
12 0.43
13 0.43
14 0.45
15 0.54
16 0.6
17 0.57
18 0.58
19 0.53
20 0.49
21 0.49
22 0.45
23 0.4
24 0.36
25 0.34
26 0.31
27 0.3
28 0.28
29 0.27
30 0.27
31 0.28
32 0.36
33 0.36
34 0.36
35 0.39
36 0.38
37 0.38
38 0.38
39 0.35
40 0.3
41 0.37
42 0.38
43 0.35
44 0.35
45 0.33
46 0.33
47 0.3
48 0.26
49 0.17
50 0.15
51 0.12
52 0.13
53 0.11
54 0.1
55 0.1
56 0.1
57 0.13
58 0.13
59 0.16
60 0.16
61 0.16
62 0.16
63 0.15
64 0.15
65 0.11
66 0.11
67 0.07
68 0.07
69 0.07
70 0.07
71 0.08
72 0.1
73 0.09
74 0.09
75 0.09
76 0.13
77 0.13
78 0.16
79 0.21
80 0.2
81 0.26
82 0.26
83 0.28
84 0.27
85 0.31
86 0.34
87 0.34
88 0.34
89 0.32
90 0.31
91 0.29
92 0.27
93 0.22
94 0.16
95 0.11
96 0.09
97 0.08
98 0.07
99 0.08
100 0.09
101 0.11
102 0.11
103 0.13
104 0.15
105 0.22
106 0.26
107 0.32
108 0.38
109 0.39
110 0.48
111 0.56
112 0.57
113 0.56
114 0.6
115 0.58
116 0.59
117 0.58
118 0.52
119 0.48
120 0.48
121 0.42
122 0.35
123 0.3
124 0.23
125 0.19
126 0.16
127 0.1
128 0.08
129 0.07
130 0.07
131 0.1
132 0.13
133 0.15
134 0.2
135 0.25
136 0.31
137 0.41
138 0.5
139 0.53
140 0.57
141 0.6
142 0.63
143 0.64
144 0.57
145 0.48
146 0.39
147 0.33
148 0.26
149 0.22
150 0.14
151 0.08
152 0.09
153 0.09
154 0.1
155 0.1
156 0.16
157 0.23
158 0.28
159 0.36
160 0.43
161 0.54
162 0.61
163 0.69
164 0.73
165 0.76
166 0.76
167 0.7
168 0.67
169 0.6
170 0.54
171 0.5
172 0.42
173 0.4
174 0.38
175 0.39
176 0.37
177 0.39
178 0.42
179 0.47
180 0.56
181 0.54
182 0.61
183 0.64
184 0.68
185 0.68
186 0.67
187 0.58
188 0.47
189 0.4
190 0.3
191 0.23
192 0.15
193 0.09
194 0.04
195 0.04
196 0.04
197 0.04
198 0.05
199 0.07
200 0.09
201 0.1
202 0.12
203 0.13
204 0.15
205 0.15
206 0.16
207 0.15
208 0.15
209 0.15
210 0.18
211 0.18
212 0.2
213 0.2
214 0.24
215 0.33
216 0.39
217 0.47
218 0.51
219 0.6
220 0.63
221 0.72
222 0.75
223 0.73
224 0.72
225 0.69
226 0.7
227 0.68
228 0.7
229 0.68
230 0.7
231 0.71
232 0.76
233 0.8
234 0.78
235 0.74
236 0.74
237 0.73
238 0.7
239 0.66
240 0.61
241 0.58
242 0.55
243 0.52
244 0.46
245 0.39
246 0.32
247 0.29
248 0.23
249 0.15
250 0.09
251 0.08
252 0.07
253 0.06
254 0.06
255 0.05
256 0.05
257 0.05
258 0.07
259 0.08
260 0.09
261 0.09
262 0.15
263 0.17
264 0.18
265 0.22
266 0.21
267 0.24
268 0.31
269 0.4
270 0.43
271 0.53
272 0.61
273 0.69
274 0.78
275 0.82
276 0.82
277 0.77
278 0.77
279 0.75
280 0.72
281 0.62
282 0.57
283 0.58
284 0.54
285 0.53
286 0.44
287 0.38
288 0.35
289 0.39
290 0.39
291 0.38
292 0.44