Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XTP3

Protein Details
Accession A0A4U6XTP3   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-29IPEEAPKKRGRGRPPKAEGPKKAVYBasic
NLS Segment(s)
PositionSequence
10-66PKKRGRGRPPKAEGPKKAVYVPTGRPRGRPKGSGVVKKPATGKPATGTGRGRGRPKK
90-127KSATSTGRPRGRPRKSDASIAAPTPKKAESAQKAKERK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MAPTIPEEAPKKRGRGRPPKAEGPKKAVYVPTGRPRGRPKGSGVVKKPATGKPATGTGRGRGRPKKSDIADATTTPTAETATPKKSTPAKSATSTGRPRGRPRKSDASIAAPTPKKAESAQKAKERKSDVSIKESFCSDSSSGSDNEEQARKNVSKPPSDAADSAEEVRRWFPSKMIRGLIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.72
3 0.77
4 0.8
5 0.82
6 0.85
7 0.87
8 0.88
9 0.84
10 0.8
11 0.76
12 0.67
13 0.63
14 0.55
15 0.48
16 0.44
17 0.46
18 0.48
19 0.52
20 0.51
21 0.54
22 0.6
23 0.66
24 0.65
25 0.61
26 0.57
27 0.58
28 0.65
29 0.67
30 0.63
31 0.63
32 0.58
33 0.58
34 0.57
35 0.5
36 0.46
37 0.38
38 0.35
39 0.28
40 0.34
41 0.33
42 0.34
43 0.32
44 0.33
45 0.39
46 0.42
47 0.48
48 0.48
49 0.52
50 0.54
51 0.58
52 0.6
53 0.55
54 0.59
55 0.53
56 0.51
57 0.47
58 0.4
59 0.38
60 0.3
61 0.27
62 0.18
63 0.16
64 0.11
65 0.09
66 0.12
67 0.12
68 0.16
69 0.17
70 0.17
71 0.22
72 0.27
73 0.3
74 0.32
75 0.34
76 0.34
77 0.35
78 0.38
79 0.37
80 0.39
81 0.4
82 0.41
83 0.42
84 0.43
85 0.5
86 0.57
87 0.61
88 0.58
89 0.62
90 0.65
91 0.61
92 0.63
93 0.57
94 0.52
95 0.46
96 0.42
97 0.41
98 0.32
99 0.3
100 0.26
101 0.24
102 0.19
103 0.2
104 0.28
105 0.29
106 0.38
107 0.45
108 0.52
109 0.58
110 0.6
111 0.64
112 0.6
113 0.55
114 0.52
115 0.54
116 0.48
117 0.49
118 0.51
119 0.46
120 0.42
121 0.4
122 0.35
123 0.27
124 0.27
125 0.2
126 0.17
127 0.17
128 0.18
129 0.18
130 0.19
131 0.2
132 0.17
133 0.22
134 0.23
135 0.23
136 0.22
137 0.28
138 0.26
139 0.29
140 0.35
141 0.36
142 0.38
143 0.41
144 0.44
145 0.42
146 0.44
147 0.41
148 0.37
149 0.35
150 0.31
151 0.3
152 0.3
153 0.26
154 0.24
155 0.25
156 0.26
157 0.26
158 0.25
159 0.28
160 0.34
161 0.41
162 0.47