Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6X789

Protein Details
Accession A0A4U6X789   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-57SKGFVRIAPPRPPRRQRQPGPCPSITHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9, nucl 8, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020301  Mrx7  
Pfam View protein in Pfam  
PF10906  Mrx7  
Amino Acid Sequences MMRRCVLTKPRNSTLICTKNARSCRCHRLPGSKGFVRIAPPRPPRRQRQPGPCPSITLHDIRTVPNSHSTMAPPLNMLIRALVAFEDVIIRQILKSPGFHRGVGRVHRYVDEKRNGPLPHEPLRQGQASANPEDRGFVQYFLDELKNQFRGTPTNPPPPPGPPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.63
3 0.58
4 0.55
5 0.54
6 0.56
7 0.63
8 0.62
9 0.59
10 0.59
11 0.65
12 0.66
13 0.7
14 0.69
15 0.71
16 0.72
17 0.73
18 0.74
19 0.66
20 0.62
21 0.55
22 0.5
23 0.45
24 0.45
25 0.42
26 0.43
27 0.49
28 0.56
29 0.65
30 0.72
31 0.76
32 0.8
33 0.85
34 0.85
35 0.86
36 0.87
37 0.87
38 0.86
39 0.77
40 0.69
41 0.59
42 0.54
43 0.45
44 0.36
45 0.28
46 0.24
47 0.24
48 0.22
49 0.24
50 0.21
51 0.2
52 0.23
53 0.23
54 0.19
55 0.19
56 0.19
57 0.19
58 0.18
59 0.17
60 0.12
61 0.12
62 0.12
63 0.11
64 0.1
65 0.06
66 0.06
67 0.05
68 0.05
69 0.04
70 0.04
71 0.03
72 0.03
73 0.04
74 0.03
75 0.04
76 0.04
77 0.04
78 0.04
79 0.07
80 0.09
81 0.1
82 0.12
83 0.13
84 0.21
85 0.23
86 0.24
87 0.23
88 0.26
89 0.3
90 0.34
91 0.37
92 0.31
93 0.31
94 0.32
95 0.35
96 0.37
97 0.4
98 0.41
99 0.38
100 0.37
101 0.43
102 0.41
103 0.4
104 0.41
105 0.39
106 0.4
107 0.43
108 0.43
109 0.39
110 0.42
111 0.4
112 0.34
113 0.3
114 0.29
115 0.28
116 0.3
117 0.29
118 0.27
119 0.26
120 0.26
121 0.24
122 0.22
123 0.19
124 0.16
125 0.14
126 0.13
127 0.14
128 0.15
129 0.16
130 0.13
131 0.15
132 0.21
133 0.23
134 0.23
135 0.25
136 0.25
137 0.29
138 0.32
139 0.41
140 0.42
141 0.5
142 0.51
143 0.53
144 0.53
145 0.56