Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U6X430

Protein Details
Accession A0A4U6X430    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-31KSSSRPAPTGKPKQKSTKNASRVAKHydrophilic
NLS Segment(s)
PositionSequence
11-58RPAPTGKPKQKSTKNASRVAKPQKAKPHGSADKMQKKLAAGLVGRTEK
63-93RAGHLELIGKGKKAKGAKDEKTHKGGSRKYG
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGGVKSSSRPAPTGKPKQKSTKNASRVAKPQKAKPHGSADKMQKKLAAGLVGRTEKLLGDRAGHLELIGKGKKAKGAKDEKTHKGGSRKYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.62
4 0.64
5 0.7
6 0.79
7 0.84
8 0.83
9 0.82
10 0.82
11 0.8
12 0.8
13 0.77
14 0.73
15 0.73
16 0.73
17 0.71
18 0.65
19 0.64
20 0.66
21 0.67
22 0.65
23 0.61
24 0.61
25 0.58
26 0.58
27 0.58
28 0.58
29 0.59
30 0.57
31 0.52
32 0.43
33 0.38
34 0.35
35 0.29
36 0.22
37 0.14
38 0.14
39 0.17
40 0.17
41 0.17
42 0.15
43 0.14
44 0.11
45 0.12
46 0.14
47 0.1
48 0.11
49 0.12
50 0.14
51 0.15
52 0.14
53 0.13
54 0.12
55 0.13
56 0.17
57 0.18
58 0.17
59 0.19
60 0.2
61 0.26
62 0.28
63 0.32
64 0.36
65 0.46
66 0.53
67 0.61
68 0.69
69 0.71
70 0.73
71 0.73
72 0.69
73 0.69