Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6X074

Protein Details
Accession A0A4U6X074   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
406-428VDERGSWRCERRREEREWDRDELAcidic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 9, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR011118  Tannase/feruloyl_esterase  
Gene Ontology GO:0030600  F:feruloyl esterase activity  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF07519  Tannase  
Amino Acid Sequences MRGLTFFHCVSIASSTDAGHDHKTWEEAPWALNDDGTINERLLVNYAHVSVHDMTVIAKSVVAQYYSRAPRYSYWSGCSTGGRQGVIEAQRYPGDYDGILAGAPAVNQPSLIVSTYWPQFVMNRKGFFPHVCEMILMTQLAIDACDELDGVKDGVIADPDSCAFDPASVVGRELDCGDRKMTMSAETAEIAREIWRGPHGADGKPLWLAKGYPVGAPFTGRFGLGNTNCSVAGQGCVGQPFRMSVEWIRNLVRKDPGYDVGGMSVADLEAAYETSRREYDGIIGSRDADLSEFKRRGGRMISWHGLSDECVTMRTSRDFYDRVLAADAGAGGYYRHYEAPGVFHCYGLNGTYYPLKALEALRTWVEEGRAPEVLDGYKVTGRNETESPTRPLCAYPSSVRFVGGGVDERGSWRCERRREEREWDRDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.17
4 0.18
5 0.19
6 0.2
7 0.2
8 0.2
9 0.2
10 0.24
11 0.23
12 0.23
13 0.24
14 0.22
15 0.22
16 0.22
17 0.25
18 0.22
19 0.21
20 0.18
21 0.16
22 0.16
23 0.18
24 0.17
25 0.12
26 0.14
27 0.14
28 0.15
29 0.16
30 0.14
31 0.13
32 0.13
33 0.14
34 0.13
35 0.12
36 0.16
37 0.15
38 0.15
39 0.13
40 0.11
41 0.11
42 0.12
43 0.13
44 0.09
45 0.08
46 0.08
47 0.11
48 0.12
49 0.13
50 0.12
51 0.13
52 0.23
53 0.28
54 0.3
55 0.29
56 0.29
57 0.31
58 0.4
59 0.46
60 0.4
61 0.39
62 0.39
63 0.41
64 0.4
65 0.39
66 0.33
67 0.31
68 0.3
69 0.26
70 0.22
71 0.21
72 0.25
73 0.25
74 0.25
75 0.2
76 0.2
77 0.21
78 0.22
79 0.22
80 0.17
81 0.15
82 0.12
83 0.12
84 0.1
85 0.09
86 0.08
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.06
93 0.05
94 0.05
95 0.06
96 0.06
97 0.07
98 0.08
99 0.08
100 0.08
101 0.12
102 0.14
103 0.14
104 0.13
105 0.13
106 0.16
107 0.24
108 0.32
109 0.34
110 0.34
111 0.35
112 0.37
113 0.39
114 0.37
115 0.34
116 0.27
117 0.23
118 0.21
119 0.21
120 0.19
121 0.17
122 0.16
123 0.11
124 0.08
125 0.06
126 0.06
127 0.06
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.03
135 0.04
136 0.05
137 0.05
138 0.04
139 0.05
140 0.05
141 0.06
142 0.06
143 0.06
144 0.05
145 0.06
146 0.06
147 0.07
148 0.07
149 0.08
150 0.07
151 0.07
152 0.07
153 0.07
154 0.1
155 0.08
156 0.09
157 0.09
158 0.09
159 0.09
160 0.1
161 0.12
162 0.11
163 0.12
164 0.12
165 0.12
166 0.12
167 0.13
168 0.13
169 0.12
170 0.11
171 0.11
172 0.11
173 0.11
174 0.11
175 0.09
176 0.09
177 0.07
178 0.07
179 0.06
180 0.06
181 0.06
182 0.07
183 0.08
184 0.08
185 0.14
186 0.16
187 0.16
188 0.18
189 0.17
190 0.17
191 0.18
192 0.18
193 0.12
194 0.1
195 0.1
196 0.08
197 0.12
198 0.12
199 0.11
200 0.12
201 0.13
202 0.12
203 0.13
204 0.12
205 0.1
206 0.09
207 0.08
208 0.08
209 0.08
210 0.14
211 0.14
212 0.16
213 0.14
214 0.15
215 0.15
216 0.14
217 0.14
218 0.08
219 0.08
220 0.06
221 0.07
222 0.07
223 0.08
224 0.09
225 0.08
226 0.08
227 0.08
228 0.09
229 0.08
230 0.09
231 0.1
232 0.16
233 0.18
234 0.2
235 0.22
236 0.24
237 0.25
238 0.26
239 0.29
240 0.24
241 0.25
242 0.25
243 0.26
244 0.24
245 0.23
246 0.2
247 0.15
248 0.14
249 0.12
250 0.09
251 0.06
252 0.04
253 0.04
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.04
260 0.05
261 0.07
262 0.07
263 0.08
264 0.09
265 0.09
266 0.13
267 0.18
268 0.19
269 0.19
270 0.19
271 0.19
272 0.18
273 0.18
274 0.14
275 0.08
276 0.09
277 0.11
278 0.19
279 0.19
280 0.2
281 0.25
282 0.25
283 0.28
284 0.3
285 0.32
286 0.31
287 0.38
288 0.41
289 0.37
290 0.37
291 0.34
292 0.3
293 0.26
294 0.2
295 0.14
296 0.11
297 0.11
298 0.11
299 0.12
300 0.14
301 0.16
302 0.16
303 0.17
304 0.21
305 0.22
306 0.22
307 0.28
308 0.26
309 0.24
310 0.24
311 0.22
312 0.17
313 0.16
314 0.14
315 0.07
316 0.07
317 0.06
318 0.04
319 0.04
320 0.06
321 0.07
322 0.07
323 0.08
324 0.09
325 0.1
326 0.16
327 0.18
328 0.24
329 0.23
330 0.23
331 0.22
332 0.22
333 0.22
334 0.17
335 0.16
336 0.09
337 0.11
338 0.13
339 0.14
340 0.14
341 0.13
342 0.13
343 0.14
344 0.16
345 0.19
346 0.18
347 0.21
348 0.2
349 0.21
350 0.22
351 0.21
352 0.21
353 0.19
354 0.19
355 0.2
356 0.21
357 0.2
358 0.19
359 0.19
360 0.18
361 0.16
362 0.14
363 0.13
364 0.16
365 0.17
366 0.18
367 0.22
368 0.23
369 0.27
370 0.28
371 0.3
372 0.33
373 0.36
374 0.41
375 0.38
376 0.37
377 0.34
378 0.34
379 0.33
380 0.3
381 0.31
382 0.32
383 0.35
384 0.39
385 0.38
386 0.37
387 0.33
388 0.3
389 0.26
390 0.21
391 0.19
392 0.16
393 0.16
394 0.16
395 0.18
396 0.2
397 0.21
398 0.24
399 0.3
400 0.37
401 0.46
402 0.55
403 0.63
404 0.69
405 0.75
406 0.81
407 0.82
408 0.84