Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XCX9

Protein Details
Accession A0A4U6XCX9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
323-346HAPRHGFRLKKLDKFKARRGSAKLBasic
NLS Segment(s)
PositionSequence
323-346HAPRHGFRLKKLDKFKARRGSAKL
Subcellular Location(s) cyto 11.5, mito 8, cyto_nucl 7, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF13417  GST_N_3  
CDD cd00570  GST_N_family  
Amino Acid Sequences MASSDEDKKIVLYHYSASPYARRIVWYLALRGIPYVQCMQPPVLPRPDVEMLGIVHRRIPILTIGRDIYLDTRLMLRKLEQLYPSRARLGAEGPEHAAMERLLETLIIDGGVFSNAINVLPTNLPMLQDPNRTWFKDREGYVGGKLSAETMQRGRPTAINEIRRTMELLETTLLTDGRDWVLKTEGPRLADIEAVWLPHWLASIPGALPKEQISIEKFPRVFAWIERFQKTVSEAKKAAPKVETVSGDEAASLVASSPYNDAGGRVDAEDALVAAEGLKAGDEIILWPADTGASHKDTGKLLSLDGDEVVIEVQGQKGSARVHAPRHGFRLKKLDKFKARRGSAKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.29
5 0.3
6 0.29
7 0.32
8 0.3
9 0.28
10 0.27
11 0.29
12 0.34
13 0.34
14 0.34
15 0.33
16 0.33
17 0.31
18 0.29
19 0.28
20 0.21
21 0.2
22 0.21
23 0.18
24 0.19
25 0.21
26 0.22
27 0.23
28 0.28
29 0.31
30 0.33
31 0.32
32 0.31
33 0.36
34 0.36
35 0.33
36 0.28
37 0.25
38 0.19
39 0.25
40 0.26
41 0.2
42 0.2
43 0.2
44 0.19
45 0.17
46 0.18
47 0.18
48 0.22
49 0.23
50 0.24
51 0.24
52 0.24
53 0.24
54 0.23
55 0.19
56 0.15
57 0.13
58 0.11
59 0.14
60 0.17
61 0.17
62 0.18
63 0.18
64 0.23
65 0.26
66 0.3
67 0.3
68 0.32
69 0.39
70 0.43
71 0.43
72 0.39
73 0.37
74 0.33
75 0.3
76 0.27
77 0.25
78 0.21
79 0.2
80 0.19
81 0.19
82 0.18
83 0.16
84 0.15
85 0.09
86 0.09
87 0.08
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.05
94 0.04
95 0.04
96 0.03
97 0.04
98 0.04
99 0.04
100 0.03
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.06
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.08
113 0.13
114 0.15
115 0.19
116 0.19
117 0.24
118 0.27
119 0.28
120 0.32
121 0.3
122 0.32
123 0.35
124 0.35
125 0.33
126 0.32
127 0.32
128 0.3
129 0.28
130 0.23
131 0.17
132 0.16
133 0.12
134 0.11
135 0.1
136 0.11
137 0.11
138 0.14
139 0.15
140 0.16
141 0.16
142 0.16
143 0.18
144 0.25
145 0.3
146 0.33
147 0.34
148 0.35
149 0.35
150 0.33
151 0.31
152 0.22
153 0.17
154 0.11
155 0.11
156 0.09
157 0.08
158 0.08
159 0.08
160 0.07
161 0.06
162 0.05
163 0.05
164 0.05
165 0.07
166 0.06
167 0.07
168 0.08
169 0.1
170 0.11
171 0.16
172 0.18
173 0.17
174 0.18
175 0.18
176 0.17
177 0.16
178 0.14
179 0.11
180 0.09
181 0.09
182 0.09
183 0.08
184 0.07
185 0.07
186 0.07
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.08
193 0.09
194 0.09
195 0.09
196 0.1
197 0.11
198 0.1
199 0.13
200 0.14
201 0.19
202 0.21
203 0.26
204 0.26
205 0.25
206 0.25
207 0.25
208 0.22
209 0.2
210 0.25
211 0.27
212 0.32
213 0.33
214 0.33
215 0.31
216 0.32
217 0.32
218 0.32
219 0.27
220 0.28
221 0.27
222 0.3
223 0.37
224 0.37
225 0.36
226 0.3
227 0.29
228 0.27
229 0.31
230 0.29
231 0.24
232 0.26
233 0.23
234 0.22
235 0.2
236 0.16
237 0.11
238 0.09
239 0.06
240 0.04
241 0.04
242 0.04
243 0.05
244 0.06
245 0.07
246 0.08
247 0.08
248 0.08
249 0.09
250 0.1
251 0.1
252 0.09
253 0.09
254 0.08
255 0.08
256 0.08
257 0.06
258 0.05
259 0.04
260 0.04
261 0.03
262 0.03
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.04
269 0.04
270 0.04
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.06
278 0.08
279 0.1
280 0.13
281 0.15
282 0.16
283 0.19
284 0.2
285 0.22
286 0.25
287 0.22
288 0.19
289 0.21
290 0.2
291 0.18
292 0.17
293 0.15
294 0.09
295 0.09
296 0.09
297 0.06
298 0.05
299 0.05
300 0.06
301 0.06
302 0.07
303 0.07
304 0.11
305 0.12
306 0.16
307 0.22
308 0.27
309 0.33
310 0.41
311 0.48
312 0.5
313 0.57
314 0.62
315 0.59
316 0.6
317 0.65
318 0.66
319 0.68
320 0.72
321 0.75
322 0.77
323 0.82
324 0.86
325 0.85
326 0.84