Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5FG03

Protein Details
Accession C5FG03    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-29DLEDEKEKKLYKKRAKEGRMIRLPKBasic
NLS Segment(s)
PositionSequence
12-23KKLYKKRAKEGR
Subcellular Location(s) cyto 14, nucl 10, mito 2
Family & Domain DBs
Amino Acid Sequences MKVDDLEDEKEKKLYKKRAKEGRMIRLPKDLMIDDDFIPVYFGRGGRGPVGGGPGQGGNCVAYPAIAKMAVYNVFGVKVCGVMINRFGKDWLDEMEDGLYIINNGLRRVEDLVKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.66
4 0.74
5 0.81
6 0.83
7 0.85
8 0.84
9 0.84
10 0.84
11 0.78
12 0.7
13 0.66
14 0.61
15 0.52
16 0.45
17 0.35
18 0.28
19 0.25
20 0.25
21 0.18
22 0.18
23 0.16
24 0.13
25 0.13
26 0.1
27 0.09
28 0.08
29 0.08
30 0.08
31 0.09
32 0.1
33 0.1
34 0.1
35 0.09
36 0.08
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.04
55 0.05
56 0.07
57 0.07
58 0.07
59 0.08
60 0.07
61 0.08
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.07
68 0.08
69 0.09
70 0.15
71 0.18
72 0.18
73 0.19
74 0.19
75 0.18
76 0.19
77 0.19
78 0.16
79 0.16
80 0.15
81 0.16
82 0.16
83 0.14
84 0.13
85 0.11
86 0.09
87 0.05
88 0.06
89 0.07
90 0.08
91 0.09
92 0.1
93 0.11
94 0.13
95 0.18