Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XRA6

Protein Details
Accession A0A4U6XRA6   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
30-49ADYKRRHCRWPTRNVFKGRPBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8.833, cyto 6, cysk 5, mito 4, cyto_pero 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR011118  Tannase/feruloyl_esterase  
Gene Ontology GO:0052689  F:carboxylic ester hydrolase activity  
Pfam View protein in Pfam  
PF07519  Tannase  
Amino Acid Sequences MAMVRWVEEGVAPEHVTGTAFVDNTVGGGADYKRRHCRWPTRNVFKGRPGDFKNENTNSECVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.08
10 0.08
11 0.07
12 0.07
13 0.05
14 0.03
15 0.04
16 0.05
17 0.11
18 0.13
19 0.18
20 0.25
21 0.28
22 0.34
23 0.41
24 0.52
25 0.55
26 0.64
27 0.7
28 0.73
29 0.79
30 0.81
31 0.78
32 0.75
33 0.75
34 0.68
35 0.66
36 0.59
37 0.59
38 0.57
39 0.57
40 0.59
41 0.55
42 0.54
43 0.49
44 0.48