Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U6X060

Protein Details
Accession A0A4U6X060    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-33NDDPGRRQTCKPRSPRHRGQGARLLRBasic
71-104QGSRVGSAFRRRRRRRCRRRCRRRSPLQHARAYABasic
NLS Segment(s)
PositionSequence
76-95GSAFRRRRRRRCRRRCRRRS
156-169TRKKKTPGSGPYKR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGSPGWANDDPGRRQTCKPRSPRHRGQGARLLRPGTPVIPKSLQDLAARHTDSAHAPPPKGIWHDTAGARQGSRVGSAFRRRRRRRCRRRCRRRSPLQHARAYADQRVLQHLQRAEARQHPGGGGGSLACVVGSPGHSAERKEGRSNGCEAGIVKTRKKKTPGSGPYKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.57
3 0.62
4 0.65
5 0.72
6 0.75
7 0.8
8 0.86
9 0.9
10 0.89
11 0.89
12 0.84
13 0.82
14 0.8
15 0.77
16 0.73
17 0.67
18 0.58
19 0.48
20 0.46
21 0.39
22 0.33
23 0.31
24 0.26
25 0.27
26 0.28
27 0.28
28 0.29
29 0.3
30 0.3
31 0.26
32 0.27
33 0.24
34 0.27
35 0.27
36 0.23
37 0.21
38 0.19
39 0.18
40 0.2
41 0.24
42 0.21
43 0.21
44 0.21
45 0.22
46 0.23
47 0.24
48 0.23
49 0.19
50 0.18
51 0.22
52 0.22
53 0.23
54 0.23
55 0.21
56 0.19
57 0.16
58 0.16
59 0.12
60 0.12
61 0.11
62 0.1
63 0.15
64 0.25
65 0.33
66 0.4
67 0.51
68 0.6
69 0.7
70 0.8
71 0.86
72 0.88
73 0.91
74 0.94
75 0.94
76 0.97
77 0.97
78 0.97
79 0.96
80 0.96
81 0.95
82 0.95
83 0.94
84 0.91
85 0.85
86 0.75
87 0.68
88 0.62
89 0.53
90 0.44
91 0.36
92 0.29
93 0.25
94 0.28
95 0.26
96 0.22
97 0.24
98 0.23
99 0.23
100 0.25
101 0.27
102 0.26
103 0.29
104 0.33
105 0.29
106 0.29
107 0.26
108 0.24
109 0.21
110 0.18
111 0.12
112 0.08
113 0.07
114 0.06
115 0.06
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.06
122 0.07
123 0.12
124 0.14
125 0.15
126 0.22
127 0.3
128 0.33
129 0.37
130 0.42
131 0.43
132 0.45
133 0.47
134 0.42
135 0.34
136 0.32
137 0.28
138 0.27
139 0.31
140 0.33
141 0.37
142 0.44
143 0.51
144 0.57
145 0.63
146 0.66
147 0.68
148 0.74
149 0.77