Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U6XHJ3

Protein Details
Accession A0A4U6XHJ3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPSTPMPRRKVKTNKPNKPNKQTSKKPSAAAHydrophilic
NLS Segment(s)
PositionSequence
8-26RRKVKTNKPNKPNKQTSKK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MPSTPMPRRKVKTNKPNKPNKQTSKKPSAAATPSTTTAIQTSNTKSFVTEATPRKDGPIPLDLSSTRQGKSPDLTIRSISPSPALSTPTRPLTERPRLVVPFQKARFEHTLAVARVHRAIAAIRKCRAKMKRLHDLFNQHQDSANLVLLDASVVAASDRLVQAVEDDERTRAGNPPGYVRYPAEMIPELLASVEKAEADRYKWTSKLKRLRLLLDIISGGTMPNLKRILEAARDKMAALRTPRKVVQDRPEPPYPLDLPDGMKKRYPALKGLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.94
4 0.94
5 0.94
6 0.94
7 0.94
8 0.93
9 0.93
10 0.93
11 0.92
12 0.87
13 0.8
14 0.73
15 0.7
16 0.65
17 0.59
18 0.54
19 0.46
20 0.42
21 0.4
22 0.36
23 0.28
24 0.24
25 0.21
26 0.18
27 0.19
28 0.23
29 0.24
30 0.26
31 0.25
32 0.24
33 0.24
34 0.23
35 0.24
36 0.27
37 0.3
38 0.34
39 0.37
40 0.37
41 0.39
42 0.41
43 0.38
44 0.34
45 0.33
46 0.3
47 0.29
48 0.32
49 0.28
50 0.28
51 0.32
52 0.31
53 0.24
54 0.25
55 0.26
56 0.26
57 0.28
58 0.31
59 0.32
60 0.32
61 0.34
62 0.32
63 0.32
64 0.34
65 0.32
66 0.26
67 0.2
68 0.17
69 0.18
70 0.18
71 0.19
72 0.16
73 0.19
74 0.23
75 0.25
76 0.26
77 0.25
78 0.29
79 0.35
80 0.43
81 0.42
82 0.41
83 0.42
84 0.42
85 0.44
86 0.46
87 0.42
88 0.41
89 0.41
90 0.44
91 0.38
92 0.42
93 0.43
94 0.38
95 0.34
96 0.28
97 0.33
98 0.27
99 0.29
100 0.25
101 0.21
102 0.2
103 0.18
104 0.15
105 0.1
106 0.11
107 0.15
108 0.2
109 0.24
110 0.27
111 0.3
112 0.31
113 0.39
114 0.42
115 0.43
116 0.46
117 0.49
118 0.56
119 0.56
120 0.59
121 0.56
122 0.59
123 0.55
124 0.55
125 0.49
126 0.39
127 0.36
128 0.32
129 0.29
130 0.22
131 0.19
132 0.09
133 0.08
134 0.07
135 0.06
136 0.06
137 0.05
138 0.03
139 0.02
140 0.02
141 0.02
142 0.02
143 0.03
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.07
152 0.07
153 0.08
154 0.08
155 0.09
156 0.1
157 0.1
158 0.12
159 0.14
160 0.17
161 0.17
162 0.22
163 0.24
164 0.25
165 0.26
166 0.23
167 0.22
168 0.2
169 0.2
170 0.18
171 0.16
172 0.15
173 0.13
174 0.12
175 0.1
176 0.09
177 0.09
178 0.05
179 0.05
180 0.05
181 0.04
182 0.05
183 0.08
184 0.09
185 0.11
186 0.16
187 0.2
188 0.23
189 0.27
190 0.36
191 0.42
192 0.51
193 0.59
194 0.63
195 0.67
196 0.69
197 0.68
198 0.63
199 0.59
200 0.5
201 0.41
202 0.33
203 0.24
204 0.2
205 0.16
206 0.11
207 0.08
208 0.1
209 0.08
210 0.13
211 0.15
212 0.15
213 0.15
214 0.18
215 0.21
216 0.26
217 0.32
218 0.31
219 0.33
220 0.33
221 0.33
222 0.34
223 0.34
224 0.31
225 0.33
226 0.38
227 0.39
228 0.44
229 0.48
230 0.53
231 0.57
232 0.6
233 0.62
234 0.64
235 0.65
236 0.67
237 0.7
238 0.64
239 0.59
240 0.57
241 0.49
242 0.42
243 0.38
244 0.33
245 0.31
246 0.37
247 0.41
248 0.37
249 0.4
250 0.38
251 0.42
252 0.47
253 0.47