Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XCF2

Protein Details
Accession A0A4U6XCF2   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-78MTYVGKPPEKPKNKKKKPEGKPKPKESGGRBasic
NLS Segment(s)
PositionSequence
54-84KPPEKPKNKKKKPEGKPKPKESGGRVGGGGR
Subcellular Location(s) extr 7E.R. 7, mito 5, nucl 2, plas 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MRLLIFLLLPTAVLVNGGCTDCGTPNTGSGSHLMFYGGDMGGTNYGVPMTYVGKPPEKPKNKKKKPEGKPKPKESGGRVGGGGRVGGGGGGGDLMESSGGHSNDKRGEEEEQFPGIQRPRVLAKVFEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.08
5 0.08
6 0.08
7 0.09
8 0.1
9 0.11
10 0.13
11 0.12
12 0.13
13 0.16
14 0.15
15 0.15
16 0.15
17 0.15
18 0.12
19 0.12
20 0.11
21 0.08
22 0.08
23 0.09
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.06
37 0.08
38 0.11
39 0.13
40 0.17
41 0.19
42 0.25
43 0.35
44 0.42
45 0.5
46 0.58
47 0.68
48 0.75
49 0.83
50 0.88
51 0.88
52 0.89
53 0.91
54 0.91
55 0.91
56 0.91
57 0.89
58 0.86
59 0.81
60 0.76
61 0.68
62 0.67
63 0.57
64 0.49
65 0.41
66 0.34
67 0.29
68 0.23
69 0.19
70 0.09
71 0.07
72 0.05
73 0.04
74 0.03
75 0.02
76 0.02
77 0.02
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.04
85 0.09
86 0.09
87 0.12
88 0.13
89 0.17
90 0.22
91 0.24
92 0.24
93 0.22
94 0.27
95 0.29
96 0.32
97 0.32
98 0.3
99 0.28
100 0.27
101 0.31
102 0.3
103 0.3
104 0.26
105 0.27
106 0.3
107 0.36
108 0.37