Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U6X0D2

Protein Details
Accession A0A4U6X0D2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
92-113PCTPCTPSSTRPRTRSRWRGPRHydrophilic
NLS Segment(s)
PositionSequence
110-110R
Subcellular Location(s) mito 16, cyto 6, nucl 3, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MAKALGVKTQKQGDATLLGPMPCSLSSAGMSLVFGFDGDAVKMSVPLSNLMVPDTGNWRRRSGSMPHAAERRLGGRLGQRAHEPRRAVLCRPCTPCTPSSTRPRTRSRWRGPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.24
4 0.21
5 0.18
6 0.17
7 0.16
8 0.15
9 0.12
10 0.13
11 0.1
12 0.09
13 0.1
14 0.1
15 0.11
16 0.09
17 0.09
18 0.08
19 0.07
20 0.06
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.06
32 0.06
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.09
39 0.07
40 0.08
41 0.13
42 0.18
43 0.23
44 0.24
45 0.25
46 0.26
47 0.28
48 0.31
49 0.3
50 0.32
51 0.36
52 0.37
53 0.4
54 0.41
55 0.4
56 0.37
57 0.34
58 0.27
59 0.19
60 0.17
61 0.15
62 0.18
63 0.23
64 0.24
65 0.24
66 0.29
67 0.35
68 0.4
69 0.44
70 0.4
71 0.38
72 0.46
73 0.47
74 0.47
75 0.47
76 0.51
77 0.53
78 0.57
79 0.57
80 0.52
81 0.54
82 0.52
83 0.51
84 0.51
85 0.51
86 0.56
87 0.63
88 0.68
89 0.71
90 0.77
91 0.8
92 0.83
93 0.86