Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6X254

Protein Details
Accession A0A4U6X254    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-52IHPPPPPFRLQERKKTSRRKKKIEKRMPRQGPAVTBasic
NLS Segment(s)
PositionSequence
26-46RLQERKKTSRRKKKIEKRMPR
Subcellular Location(s) cyto 13.5, cyto_nucl 7.5, plas 6, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002022  Pec_lyase  
IPR012334  Pectin_lyas_fold  
IPR011050  Pectin_lyase_fold/virulence  
IPR045032  PEL  
Gene Ontology GO:0005576  C:extracellular region  
GO:0030570  F:pectate lyase activity  
Pfam View protein in Pfam  
PF00544  Pectate_lyase_4  
Amino Acid Sequences MYDIASGLYVSFHGPEGIHPPPPPFRLQERKKTSRRKKKIEKRMPRQGPAVTQVGSRLTRLLLLLLPLLTLLPALGAGAATTDAVTCARCDDVAHGFASLNGGTTGGKGGRIVTATSHAELVAYADATEPLVIRVEGELASEPRGYEIPVRSHKTIVGVGAGAKILGGGFGITNQSNIILRNLQVSDTYIPEDYNGKSEDWDGIQVDGGTNLWIDHVTVRFSPLPASYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.16
4 0.18
5 0.21
6 0.21
7 0.25
8 0.3
9 0.33
10 0.35
11 0.34
12 0.42
13 0.49
14 0.57
15 0.63
16 0.68
17 0.75
18 0.82
19 0.88
20 0.9
21 0.9
22 0.92
23 0.92
24 0.94
25 0.94
26 0.96
27 0.96
28 0.96
29 0.95
30 0.95
31 0.93
32 0.86
33 0.81
34 0.73
35 0.66
36 0.59
37 0.52
38 0.41
39 0.32
40 0.29
41 0.27
42 0.24
43 0.2
44 0.16
45 0.13
46 0.13
47 0.13
48 0.12
49 0.08
50 0.08
51 0.09
52 0.08
53 0.07
54 0.06
55 0.06
56 0.05
57 0.04
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.04
73 0.04
74 0.05
75 0.05
76 0.05
77 0.06
78 0.08
79 0.1
80 0.11
81 0.11
82 0.11
83 0.1
84 0.1
85 0.11
86 0.09
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.09
102 0.1
103 0.1
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.05
110 0.04
111 0.04
112 0.04
113 0.04
114 0.04
115 0.04
116 0.03
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.07
129 0.07
130 0.08
131 0.08
132 0.08
133 0.11
134 0.14
135 0.2
136 0.27
137 0.32
138 0.32
139 0.33
140 0.33
141 0.32
142 0.29
143 0.23
144 0.16
145 0.12
146 0.11
147 0.11
148 0.1
149 0.07
150 0.05
151 0.05
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.06
159 0.06
160 0.06
161 0.06
162 0.08
163 0.08
164 0.09
165 0.11
166 0.11
167 0.11
168 0.15
169 0.15
170 0.15
171 0.14
172 0.16
173 0.15
174 0.15
175 0.17
176 0.14
177 0.13
178 0.14
179 0.17
180 0.15
181 0.17
182 0.17
183 0.15
184 0.16
185 0.17
186 0.18
187 0.16
188 0.18
189 0.15
190 0.14
191 0.14
192 0.14
193 0.13
194 0.11
195 0.1
196 0.08
197 0.07
198 0.06
199 0.06
200 0.06
201 0.06
202 0.09
203 0.11
204 0.14
205 0.14
206 0.19
207 0.2
208 0.2
209 0.22