Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XS66

Protein Details
Accession A0A4U6XS66   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-35GPGAEERQKKKKPQLQGAAEDHydrophilic
55-88SSQSPPAAEEKKKKNKNKKKKKKEEKTGTQMRHYBasic
NLS Segment(s)
PositionSequence
23-26KKKK
42-80ARREKPNGERKASSSQSPPAAEEKKKKNKNKKKKKKEEK
Subcellular Location(s) nucl 15, cyto_nucl 12.333, mito_nucl 8.833, cyto 8.5
Family & Domain DBs
Amino Acid Sequences MPSVLGLTTDPSPHGPGAEERQKKKKPQLQGAAEDVDNKQLARREKPNGERKASSSQSPPAAEEKKKKNKNKKKKKKEEKTGTQMRHYSSDEEESSDEEGPLNTIKLRNHAKAIEMETLLWGALCHKPKSALKYIGKGAIMCNPIVFGDTEVYSERSEPTLKEMLKEHADPPLSFKMHKPHVCEVGLMAMSICCDVTFFRMGDDNVLEAEECRISSSWRQCASGDWEMGSCMAGWQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.2
4 0.28
5 0.37
6 0.43
7 0.48
8 0.59
9 0.66
10 0.73
11 0.79
12 0.77
13 0.77
14 0.79
15 0.83
16 0.8
17 0.78
18 0.73
19 0.66
20 0.58
21 0.5
22 0.4
23 0.32
24 0.25
25 0.19
26 0.18
27 0.2
28 0.25
29 0.3
30 0.37
31 0.43
32 0.51
33 0.62
34 0.68
35 0.71
36 0.72
37 0.68
38 0.65
39 0.66
40 0.59
41 0.53
42 0.47
43 0.43
44 0.42
45 0.4
46 0.37
47 0.35
48 0.39
49 0.42
50 0.47
51 0.53
52 0.59
53 0.68
54 0.76
55 0.8
56 0.85
57 0.9
58 0.92
59 0.93
60 0.94
61 0.96
62 0.97
63 0.97
64 0.97
65 0.97
66 0.95
67 0.94
68 0.92
69 0.85
70 0.8
71 0.72
72 0.62
73 0.55
74 0.46
75 0.38
76 0.3
77 0.29
78 0.23
79 0.21
80 0.2
81 0.17
82 0.17
83 0.15
84 0.13
85 0.09
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.09
92 0.1
93 0.16
94 0.21
95 0.22
96 0.24
97 0.24
98 0.25
99 0.25
100 0.27
101 0.22
102 0.17
103 0.16
104 0.13
105 0.13
106 0.11
107 0.08
108 0.05
109 0.05
110 0.09
111 0.12
112 0.12
113 0.13
114 0.18
115 0.2
116 0.26
117 0.31
118 0.36
119 0.36
120 0.39
121 0.41
122 0.4
123 0.38
124 0.32
125 0.26
126 0.23
127 0.21
128 0.17
129 0.15
130 0.12
131 0.11
132 0.11
133 0.11
134 0.06
135 0.06
136 0.06
137 0.08
138 0.09
139 0.1
140 0.1
141 0.1
142 0.1
143 0.11
144 0.12
145 0.11
146 0.15
147 0.2
148 0.2
149 0.21
150 0.23
151 0.25
152 0.28
153 0.29
154 0.25
155 0.24
156 0.26
157 0.24
158 0.27
159 0.3
160 0.28
161 0.27
162 0.3
163 0.33
164 0.41
165 0.45
166 0.45
167 0.44
168 0.49
169 0.48
170 0.45
171 0.37
172 0.31
173 0.27
174 0.21
175 0.15
176 0.09
177 0.09
178 0.09
179 0.08
180 0.04
181 0.04
182 0.05
183 0.08
184 0.11
185 0.11
186 0.12
187 0.15
188 0.16
189 0.18
190 0.18
191 0.16
192 0.13
193 0.13
194 0.12
195 0.09
196 0.11
197 0.09
198 0.08
199 0.1
200 0.1
201 0.13
202 0.22
203 0.3
204 0.36
205 0.38
206 0.4
207 0.39
208 0.43
209 0.47
210 0.45
211 0.38
212 0.31
213 0.28
214 0.27
215 0.27
216 0.22
217 0.14