Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U6XFR2

Protein Details
Accession A0A4U6XFR2   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
413-472DDSKDRDGRYRSRNDYRRRDRSRSPSPRRDSRVDYMDRRKRSPSRDRDRHDADKRRRVDSBasic
NLS Segment(s)
PositionSequence
425-469RNDYRRRDRSRSPSPRRDSRVDYMDRRKRSPSRDRDRHDADKRRR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MPPKRMTANPVKPARYRAGKPAAPEASDSDSDGNDDETNDAETQARAIPPPPKASSAAKIAGSLSKVNFDERRREAQEKENQRIAREKAERLAAEEGFVTEEEEEEEGEEEAVDGEGEESSSEEESSSEEEAPRRLMIRPKFIPKNQRNASKEQSGGAKDDDARYVEEEARRKAAADALVEEQIKKDLAARAAGKKHWDDDEASGSDVDTTDDLDPEAELAAWKLRELKRVKRDRDRIAEQEAEYAERERRQNLTQEERDAEDAEKLARQQEEKDAKSKMSYLQKYYHKGAFYSDEAKAYGLDKRDIMGMRIADDVKDRSALPEYLQKRDMTKLGRKGATKYKDLKSEDTGRWGEFDDRRGGGDRRGFNRHDVDERFRPDNDREVNGANAIPLGDRKAPDAPKNGRSDGYRDDDSKDRDGRYRSRNDYRRRDRSRSPSPRRDSRVDYMDRRKRSPSRDRDRHDADKRRRVDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.63
4 0.63
5 0.64
6 0.61
7 0.6
8 0.64
9 0.58
10 0.5
11 0.48
12 0.42
13 0.37
14 0.35
15 0.33
16 0.25
17 0.21
18 0.21
19 0.19
20 0.17
21 0.13
22 0.12
23 0.12
24 0.11
25 0.13
26 0.13
27 0.13
28 0.12
29 0.11
30 0.12
31 0.15
32 0.15
33 0.14
34 0.18
35 0.23
36 0.27
37 0.34
38 0.35
39 0.35
40 0.38
41 0.42
42 0.42
43 0.43
44 0.42
45 0.35
46 0.34
47 0.32
48 0.31
49 0.28
50 0.26
51 0.21
52 0.21
53 0.22
54 0.27
55 0.32
56 0.33
57 0.4
58 0.42
59 0.5
60 0.52
61 0.56
62 0.55
63 0.58
64 0.64
65 0.64
66 0.66
67 0.65
68 0.6
69 0.58
70 0.61
71 0.55
72 0.55
73 0.51
74 0.47
75 0.43
76 0.48
77 0.45
78 0.41
79 0.42
80 0.32
81 0.27
82 0.24
83 0.2
84 0.14
85 0.14
86 0.11
87 0.07
88 0.07
89 0.07
90 0.07
91 0.07
92 0.06
93 0.07
94 0.06
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.05
111 0.06
112 0.07
113 0.09
114 0.1
115 0.1
116 0.12
117 0.13
118 0.14
119 0.15
120 0.15
121 0.15
122 0.17
123 0.24
124 0.28
125 0.35
126 0.4
127 0.48
128 0.56
129 0.6
130 0.68
131 0.67
132 0.73
133 0.71
134 0.75
135 0.7
136 0.68
137 0.68
138 0.62
139 0.56
140 0.48
141 0.45
142 0.36
143 0.34
144 0.28
145 0.24
146 0.2
147 0.2
148 0.2
149 0.16
150 0.15
151 0.14
152 0.16
153 0.17
154 0.2
155 0.23
156 0.23
157 0.24
158 0.23
159 0.23
160 0.21
161 0.21
162 0.19
163 0.15
164 0.16
165 0.15
166 0.17
167 0.17
168 0.16
169 0.14
170 0.12
171 0.11
172 0.09
173 0.11
174 0.11
175 0.12
176 0.16
177 0.19
178 0.23
179 0.26
180 0.28
181 0.29
182 0.27
183 0.28
184 0.25
185 0.24
186 0.2
187 0.19
188 0.22
189 0.19
190 0.19
191 0.16
192 0.14
193 0.13
194 0.11
195 0.09
196 0.05
197 0.06
198 0.05
199 0.05
200 0.06
201 0.05
202 0.05
203 0.05
204 0.05
205 0.03
206 0.03
207 0.03
208 0.05
209 0.05
210 0.05
211 0.12
212 0.13
213 0.22
214 0.26
215 0.35
216 0.44
217 0.54
218 0.61
219 0.65
220 0.72
221 0.72
222 0.75
223 0.72
224 0.65
225 0.6
226 0.55
227 0.45
228 0.38
229 0.31
230 0.23
231 0.19
232 0.16
233 0.14
234 0.14
235 0.15
236 0.15
237 0.18
238 0.19
239 0.25
240 0.29
241 0.36
242 0.35
243 0.36
244 0.35
245 0.33
246 0.32
247 0.27
248 0.22
249 0.14
250 0.12
251 0.1
252 0.09
253 0.09
254 0.11
255 0.11
256 0.11
257 0.12
258 0.21
259 0.28
260 0.29
261 0.32
262 0.31
263 0.31
264 0.31
265 0.31
266 0.28
267 0.3
268 0.32
269 0.32
270 0.39
271 0.45
272 0.49
273 0.51
274 0.48
275 0.39
276 0.36
277 0.34
278 0.3
279 0.26
280 0.25
281 0.22
282 0.2
283 0.19
284 0.19
285 0.17
286 0.14
287 0.15
288 0.13
289 0.13
290 0.13
291 0.13
292 0.16
293 0.16
294 0.16
295 0.16
296 0.14
297 0.14
298 0.16
299 0.16
300 0.13
301 0.14
302 0.15
303 0.12
304 0.13
305 0.12
306 0.12
307 0.15
308 0.15
309 0.14
310 0.21
311 0.24
312 0.27
313 0.29
314 0.29
315 0.28
316 0.3
317 0.34
318 0.33
319 0.38
320 0.42
321 0.47
322 0.51
323 0.51
324 0.53
325 0.58
326 0.56
327 0.55
328 0.55
329 0.53
330 0.57
331 0.59
332 0.57
333 0.54
334 0.57
335 0.51
336 0.5
337 0.46
338 0.38
339 0.35
340 0.33
341 0.33
342 0.27
343 0.29
344 0.26
345 0.25
346 0.26
347 0.29
348 0.29
349 0.29
350 0.34
351 0.37
352 0.38
353 0.44
354 0.44
355 0.45
356 0.5
357 0.47
358 0.48
359 0.46
360 0.48
361 0.49
362 0.53
363 0.51
364 0.46
365 0.47
366 0.43
367 0.46
368 0.43
369 0.39
370 0.36
371 0.35
372 0.34
373 0.31
374 0.28
375 0.19
376 0.15
377 0.12
378 0.1
379 0.09
380 0.11
381 0.13
382 0.14
383 0.16
384 0.23
385 0.29
386 0.34
387 0.43
388 0.46
389 0.51
390 0.56
391 0.56
392 0.53
393 0.5
394 0.49
395 0.46
396 0.46
397 0.42
398 0.38
399 0.4
400 0.44
401 0.46
402 0.48
403 0.46
404 0.43
405 0.46
406 0.51
407 0.56
408 0.58
409 0.63
410 0.65
411 0.71
412 0.77
413 0.81
414 0.86
415 0.88
416 0.89
417 0.89
418 0.88
419 0.87
420 0.88
421 0.89
422 0.89
423 0.89
424 0.88
425 0.88
426 0.9
427 0.88
428 0.85
429 0.82
430 0.79
431 0.77
432 0.75
433 0.76
434 0.77
435 0.79
436 0.78
437 0.74
438 0.75
439 0.74
440 0.76
441 0.77
442 0.77
443 0.79
444 0.83
445 0.86
446 0.87
447 0.87
448 0.87
449 0.87
450 0.87
451 0.86
452 0.85