Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0W995

Protein Details
Accession A0A4U0W995    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20IKFRVKERRWRRDNPILFQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto_nucl 8, cyto 4
Family & Domain DBs
Amino Acid Sequences IKFRVKERRWRRDNPILFQSDDEVAVSYSIEYEELLIRTTHLLLKVEKSLLQEHNHSGKAVVFGSFLEDHNNASSTST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.7
4 0.63
5 0.55
6 0.47
7 0.37
8 0.29
9 0.21
10 0.13
11 0.1
12 0.09
13 0.08
14 0.05
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.05
21 0.05
22 0.06
23 0.06
24 0.06
25 0.07
26 0.07
27 0.08
28 0.08
29 0.1
30 0.09
31 0.12
32 0.13
33 0.13
34 0.14
35 0.15
36 0.19
37 0.21
38 0.23
39 0.24
40 0.27
41 0.31
42 0.3
43 0.28
44 0.24
45 0.21
46 0.21
47 0.19
48 0.15
49 0.1
50 0.1
51 0.13
52 0.14
53 0.13
54 0.15
55 0.15
56 0.16
57 0.18
58 0.19