Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WYF9

Protein Details
Accession A0A4U0WYF9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-42VNVPKTRRTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MGRNRRLTPSLLQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.48
4 0.42
5 0.39
6 0.45
7 0.49
8 0.51
9 0.55
10 0.57
11 0.65
12 0.73
13 0.78
14 0.81
15 0.81
16 0.86
17 0.85
18 0.87
19 0.86
20 0.86
21 0.84
22 0.84
23 0.87
24 0.79
25 0.78
26 0.71
27 0.66
28 0.58
29 0.52
30 0.42
31 0.33
32 0.32
33 0.31
34 0.3
35 0.27
36 0.32
37 0.36
38 0.39
39 0.44
40 0.48
41 0.45
42 0.51
43 0.58
44 0.56
45 0.57
46 0.56
47 0.55
48 0.54
49 0.57
50 0.48
51 0.43
52 0.4
53 0.33
54 0.36
55 0.38
56 0.37
57 0.32
58 0.39
59 0.43
60 0.52
61 0.6
62 0.63
63 0.63
64 0.66
65 0.73
66 0.73
67 0.72
68 0.69
69 0.64
70 0.61
71 0.59
72 0.54
73 0.49
74 0.47
75 0.4
76 0.35
77 0.32
78 0.32
79 0.35
80 0.41
81 0.43
82 0.47
83 0.57
84 0.63
85 0.68
86 0.66
87 0.6
88 0.56
89 0.51
90 0.49
91 0.5
92 0.5
93 0.52
94 0.54
95 0.52
96 0.49
97 0.49
98 0.42