Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XKJ3

Protein Details
Accession A0A4U0XKJ3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-77PFGGGRPGRVRRKKAKAAEKKDEGGBasic
NLS Segment(s)
PositionSequence
57-73GRPGRVRRKKAKAAEKK
Subcellular Location(s) nucl 14cyto_nucl 14, cyto 12
Family & Domain DBs
Gene Ontology GO:0005840  C:ribosome  
Amino Acid Sequences MLVFSSDNVTSGMHPDGFSNLFTQDVGKQIVNVPSFVVRLDSQKHIDFALTSPFGGGRPGRVRRKKAKAAEKKDEGGDEAEEDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.14
4 0.15
5 0.15
6 0.13
7 0.11
8 0.11
9 0.11
10 0.11
11 0.1
12 0.11
13 0.13
14 0.12
15 0.12
16 0.14
17 0.19
18 0.18
19 0.17
20 0.15
21 0.14
22 0.14
23 0.14
24 0.13
25 0.09
26 0.11
27 0.13
28 0.15
29 0.17
30 0.18
31 0.18
32 0.16
33 0.16
34 0.14
35 0.12
36 0.13
37 0.11
38 0.1
39 0.1
40 0.1
41 0.1
42 0.12
43 0.11
44 0.13
45 0.2
46 0.3
47 0.4
48 0.49
49 0.58
50 0.66
51 0.76
52 0.8
53 0.82
54 0.84
55 0.85
56 0.86
57 0.88
58 0.84
59 0.77
60 0.7
61 0.62
62 0.53
63 0.44
64 0.35
65 0.25