Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0Y1I1

Protein Details
Accession A0A4U0Y1I1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
218-245AEPMRVMEKTKRRQRHVKTVRSKLRFTVHydrophilic
NLS Segment(s)
PositionSequence
229-232RRQR
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
Amino Acid Sequences MLTRTIKRSVLEQLWASPLPPIFLLPLRASITTVSHTTSAPAIPEALTNSATQPSDSQTASPRVSQQPDVSSYQPISHSSLESIPKLPTPTSHDPSTPTTPLSDSIRELLPLLRAQSPHYITAHIHARPYLVTQGDTLRLPFLMRDVSPGDVLRLNRASLLGSRDYTLRAAAPAPVAMPVHHSPLRAKGGTLPNLAERGGYLDERLFVCRAVVMGTEAEPMRVMEKTKRRQRHVKTVRSKLRFTVLKIKEVRVRSLEEIESGEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.32
4 0.27
5 0.23
6 0.19
7 0.17
8 0.15
9 0.14
10 0.15
11 0.19
12 0.17
13 0.21
14 0.22
15 0.22
16 0.22
17 0.2
18 0.2
19 0.19
20 0.2
21 0.17
22 0.16
23 0.16
24 0.16
25 0.16
26 0.15
27 0.13
28 0.12
29 0.11
30 0.1
31 0.11
32 0.12
33 0.12
34 0.13
35 0.12
36 0.13
37 0.15
38 0.15
39 0.14
40 0.14
41 0.15
42 0.17
43 0.17
44 0.18
45 0.2
46 0.25
47 0.26
48 0.26
49 0.29
50 0.31
51 0.34
52 0.36
53 0.34
54 0.32
55 0.34
56 0.36
57 0.32
58 0.28
59 0.25
60 0.24
61 0.23
62 0.21
63 0.21
64 0.18
65 0.18
66 0.17
67 0.2
68 0.21
69 0.21
70 0.21
71 0.18
72 0.19
73 0.2
74 0.18
75 0.17
76 0.23
77 0.3
78 0.32
79 0.33
80 0.33
81 0.34
82 0.39
83 0.41
84 0.33
85 0.26
86 0.22
87 0.21
88 0.23
89 0.23
90 0.19
91 0.15
92 0.16
93 0.15
94 0.15
95 0.14
96 0.12
97 0.11
98 0.11
99 0.12
100 0.12
101 0.12
102 0.14
103 0.19
104 0.19
105 0.2
106 0.19
107 0.19
108 0.17
109 0.2
110 0.23
111 0.19
112 0.18
113 0.16
114 0.16
115 0.14
116 0.15
117 0.14
118 0.09
119 0.09
120 0.09
121 0.1
122 0.11
123 0.11
124 0.1
125 0.08
126 0.08
127 0.07
128 0.06
129 0.07
130 0.07
131 0.07
132 0.09
133 0.09
134 0.1
135 0.11
136 0.11
137 0.11
138 0.13
139 0.13
140 0.14
141 0.14
142 0.13
143 0.12
144 0.13
145 0.12
146 0.11
147 0.14
148 0.12
149 0.12
150 0.13
151 0.13
152 0.14
153 0.13
154 0.12
155 0.09
156 0.08
157 0.08
158 0.09
159 0.08
160 0.08
161 0.07
162 0.08
163 0.08
164 0.07
165 0.12
166 0.12
167 0.17
168 0.18
169 0.19
170 0.19
171 0.26
172 0.31
173 0.26
174 0.25
175 0.27
176 0.33
177 0.36
178 0.37
179 0.31
180 0.28
181 0.29
182 0.28
183 0.21
184 0.14
185 0.12
186 0.13
187 0.12
188 0.11
189 0.1
190 0.12
191 0.13
192 0.15
193 0.13
194 0.11
195 0.11
196 0.1
197 0.1
198 0.09
199 0.08
200 0.08
201 0.08
202 0.08
203 0.11
204 0.11
205 0.11
206 0.11
207 0.1
208 0.11
209 0.11
210 0.14
211 0.2
212 0.3
213 0.41
214 0.51
215 0.6
216 0.68
217 0.77
218 0.84
219 0.86
220 0.87
221 0.87
222 0.88
223 0.89
224 0.91
225 0.87
226 0.8
227 0.73
228 0.72
229 0.66
230 0.61
231 0.61
232 0.54
233 0.57
234 0.58
235 0.6
236 0.57
237 0.56
238 0.56
239 0.49
240 0.5
241 0.46
242 0.47
243 0.41
244 0.36
245 0.34