Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0V0M3

Protein Details
Accession A0A4U0V0M3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-36PTKYCKSCNIWRPPRAHHCRVCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 6, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001594  Palmitoyltrfase_DHHC  
Gene Ontology GO:0016020  C:membrane  
GO:0019706  F:protein-cysteine S-palmitoyltransferase activity  
Pfam View protein in Pfam  
PF01529  DHHC  
PROSITE View protein in PROSITE  
PS50216  DHHC  
Amino Acid Sequences MVASATSKDAAMEVPTKYCKSCNIWRPPRAHHCRVCDNCVETQDHHCVWLNNCVGRRNYRYFLVFVAPGTLLGLFLFAASLAHLLVWRSREAQGFGASISQWRVPFAMLIYGILVTPYPASLLGYHLFLMARGETTREYLNSHKFLKKDRHRPFTQGSWWKNWAAVLLRPRPPTYLRFSKKYEEGDQRFGERRGRRTAPLTKEMQGGGLGVDAGKAVEMQSVGGKTPAFQGPAMRGTIDRTPRSDGVGDPQILGGVRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.26
4 0.27
5 0.28
6 0.31
7 0.35
8 0.44
9 0.49
10 0.56
11 0.64
12 0.7
13 0.75
14 0.78
15 0.82
16 0.82
17 0.81
18 0.78
19 0.75
20 0.79
21 0.78
22 0.73
23 0.68
24 0.61
25 0.55
26 0.51
27 0.46
28 0.37
29 0.37
30 0.38
31 0.32
32 0.31
33 0.3
34 0.29
35 0.28
36 0.34
37 0.32
38 0.3
39 0.33
40 0.36
41 0.37
42 0.41
43 0.46
44 0.45
45 0.44
46 0.44
47 0.44
48 0.39
49 0.38
50 0.33
51 0.27
52 0.2
53 0.19
54 0.15
55 0.12
56 0.12
57 0.09
58 0.06
59 0.06
60 0.06
61 0.04
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.06
73 0.08
74 0.09
75 0.11
76 0.13
77 0.15
78 0.16
79 0.18
80 0.17
81 0.16
82 0.15
83 0.14
84 0.11
85 0.11
86 0.1
87 0.11
88 0.09
89 0.1
90 0.1
91 0.09
92 0.1
93 0.09
94 0.09
95 0.07
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.06
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.05
118 0.05
119 0.05
120 0.06
121 0.06
122 0.07
123 0.08
124 0.08
125 0.1
126 0.14
127 0.19
128 0.22
129 0.26
130 0.27
131 0.28
132 0.35
133 0.43
134 0.49
135 0.55
136 0.61
137 0.66
138 0.65
139 0.7
140 0.68
141 0.63
142 0.63
143 0.61
144 0.55
145 0.51
146 0.51
147 0.45
148 0.41
149 0.35
150 0.28
151 0.21
152 0.22
153 0.24
154 0.28
155 0.33
156 0.35
157 0.36
158 0.36
159 0.37
160 0.37
161 0.38
162 0.42
163 0.42
164 0.46
165 0.49
166 0.52
167 0.54
168 0.55
169 0.55
170 0.55
171 0.54
172 0.55
173 0.53
174 0.52
175 0.5
176 0.47
177 0.48
178 0.43
179 0.44
180 0.46
181 0.47
182 0.47
183 0.51
184 0.57
185 0.56
186 0.57
187 0.55
188 0.49
189 0.48
190 0.44
191 0.37
192 0.28
193 0.21
194 0.14
195 0.1
196 0.08
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.06
207 0.09
208 0.09
209 0.1
210 0.12
211 0.11
212 0.11
213 0.15
214 0.18
215 0.17
216 0.17
217 0.19
218 0.22
219 0.25
220 0.25
221 0.22
222 0.2
223 0.22
224 0.29
225 0.34
226 0.33
227 0.33
228 0.39
229 0.39
230 0.42
231 0.4
232 0.34
233 0.33
234 0.37
235 0.34
236 0.29
237 0.28
238 0.25