Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5NEH5

Protein Details
Accession A0A4V5NEH5   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQRHNRKRTRSRPRNRDGATATHydrophilic
97-123VATQTQKQTQKQKQKQRSADAQRRRVFHydrophilic
NLS Segment(s)
PositionSequence
6-17NRKRTRSRPRNR
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MGQRHNRKRTRSRPRNRDGATATHRPSGGRPATTAAHSPSPAPSPFAHSAPMPSLPRSPPATYWDQQYAAWQSRLQQQSAREQEREREPEQAPEQGVATQTQKQTQKQKQKQRSADAQRRRVFGGEEGESEALCAPMLQVVLDLFDGVDYQDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.85
4 0.82
5 0.75
6 0.73
7 0.69
8 0.66
9 0.6
10 0.53
11 0.5
12 0.42
13 0.4
14 0.4
15 0.37
16 0.29
17 0.28
18 0.28
19 0.29
20 0.3
21 0.3
22 0.24
23 0.23
24 0.22
25 0.21
26 0.2
27 0.22
28 0.21
29 0.21
30 0.18
31 0.22
32 0.24
33 0.24
34 0.24
35 0.2
36 0.21
37 0.2
38 0.25
39 0.19
40 0.18
41 0.2
42 0.2
43 0.24
44 0.26
45 0.26
46 0.22
47 0.26
48 0.3
49 0.28
50 0.31
51 0.29
52 0.26
53 0.25
54 0.26
55 0.25
56 0.21
57 0.21
58 0.18
59 0.17
60 0.24
61 0.26
62 0.24
63 0.22
64 0.22
65 0.3
66 0.37
67 0.38
68 0.33
69 0.32
70 0.36
71 0.4
72 0.43
73 0.36
74 0.34
75 0.32
76 0.35
77 0.36
78 0.34
79 0.28
80 0.23
81 0.22
82 0.17
83 0.17
84 0.13
85 0.13
86 0.14
87 0.15
88 0.21
89 0.25
90 0.31
91 0.41
92 0.49
93 0.58
94 0.64
95 0.74
96 0.78
97 0.84
98 0.86
99 0.84
100 0.85
101 0.84
102 0.85
103 0.84
104 0.84
105 0.78
106 0.73
107 0.66
108 0.57
109 0.48
110 0.41
111 0.37
112 0.29
113 0.25
114 0.25
115 0.24
116 0.22
117 0.2
118 0.16
119 0.1
120 0.08
121 0.07
122 0.04
123 0.06
124 0.06
125 0.05
126 0.06
127 0.06
128 0.07
129 0.07
130 0.07
131 0.05
132 0.05
133 0.05