Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XX26

Protein Details
Accession A0A4U0XX26    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
147-170ALDAEKVMKKPKKKTKAINLSFGDHydrophilic
NLS Segment(s)
PositionSequence
127-132RKKRKA
154-162MKKPKKKTK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSFKAKNLEYDANEPAFLRKLRAQHAGNDDRHERPLARPKKAKNEYEDDGPTYVDESNDTLSKAEYDALISGRDAKADSLKGGKDGGEESEEAPKAASHADGKGERNGGEEGPAASKQRVTEVGAVRKKRKAVKIIGQSDDEQVKGALDAEKVMKKPKKKTKAINLSFGDEEEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.27
4 0.24
5 0.24
6 0.24
7 0.28
8 0.33
9 0.42
10 0.41
11 0.43
12 0.52
13 0.56
14 0.55
15 0.55
16 0.53
17 0.47
18 0.47
19 0.43
20 0.34
21 0.34
22 0.42
23 0.44
24 0.5
25 0.56
26 0.61
27 0.69
28 0.77
29 0.75
30 0.71
31 0.7
32 0.64
33 0.62
34 0.57
35 0.47
36 0.39
37 0.33
38 0.26
39 0.2
40 0.17
41 0.1
42 0.09
43 0.08
44 0.09
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.09
59 0.08
60 0.08
61 0.08
62 0.08
63 0.09
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.11
71 0.09
72 0.09
73 0.09
74 0.07
75 0.08
76 0.08
77 0.11
78 0.11
79 0.1
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.06
86 0.07
87 0.11
88 0.13
89 0.15
90 0.17
91 0.17
92 0.16
93 0.17
94 0.18
95 0.14
96 0.13
97 0.12
98 0.1
99 0.11
100 0.12
101 0.11
102 0.11
103 0.12
104 0.11
105 0.13
106 0.14
107 0.15
108 0.2
109 0.25
110 0.34
111 0.4
112 0.46
113 0.48
114 0.51
115 0.54
116 0.56
117 0.57
118 0.56
119 0.59
120 0.62
121 0.68
122 0.71
123 0.68
124 0.63
125 0.56
126 0.52
127 0.44
128 0.34
129 0.25
130 0.18
131 0.14
132 0.12
133 0.12
134 0.1
135 0.09
136 0.11
137 0.15
138 0.19
139 0.21
140 0.31
141 0.36
142 0.42
143 0.53
144 0.62
145 0.68
146 0.74
147 0.83
148 0.85
149 0.89
150 0.88
151 0.87
152 0.8
153 0.74
154 0.65