Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0X7G5

Protein Details
Accession A0A4U0X7G5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-28GNGTNPIHNKKPKKAPKGEEDEEBasic
NLS Segment(s)
PositionSequence
15-69KKPKKAPKGEEDEEDKAFKLKQQADKKARDEMANKAKGKGPLNAGQQGIKKSGKK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.333, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MPSGVGNGTNPIHNKKPKKAPKGEEDEEDKAFKLKQQADKKARDEMANKAKGKGPLNAGQQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.64
4 0.7
5 0.77
6 0.81
7 0.8
8 0.8
9 0.82
10 0.76
11 0.7
12 0.66
13 0.59
14 0.5
15 0.43
16 0.34
17 0.25
18 0.22
19 0.19
20 0.19
21 0.21
22 0.29
23 0.37
24 0.47
25 0.54
26 0.6
27 0.61
28 0.61
29 0.58
30 0.53
31 0.47
32 0.46
33 0.48
34 0.5
35 0.48
36 0.44
37 0.46
38 0.47
39 0.48
40 0.43
41 0.39
42 0.38
43 0.43
44 0.46
45 0.43
46 0.42
47 0.43
48 0.41
49 0.41