Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0X5J8

Protein Details
Accession A0A4U0X5J8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MANKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-134EKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MAESQVTLRTRKFIRNPLLGRKQMVVDVLHPNRANVSKDELRGKLSELYKASKDQVSVFGFRTQYGGGKSTGFALIYDSNEAMKKFEPHYRLVRVGMANKIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.72
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.32
21 0.31
22 0.23
23 0.29
24 0.27
25 0.31
26 0.36
27 0.34
28 0.33
29 0.31
30 0.31
31 0.29
32 0.27
33 0.27
34 0.24
35 0.26
36 0.26
37 0.27
38 0.27
39 0.22
40 0.22
41 0.18
42 0.22
43 0.21
44 0.21
45 0.21
46 0.22
47 0.21
48 0.2
49 0.2
50 0.14
51 0.14
52 0.13
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.1
69 0.1
70 0.1
71 0.12
72 0.14
73 0.2
74 0.22
75 0.26
76 0.32
77 0.35
78 0.36
79 0.34
80 0.36
81 0.33
82 0.33
83 0.32
84 0.3
85 0.27
86 0.26
87 0.26
88 0.23
89 0.22
90 0.28
91 0.35
92 0.41
93 0.49
94 0.59
95 0.68
96 0.79
97 0.88
98 0.9
99 0.91
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.63
113 0.62
114 0.63