Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XYE5

Protein Details
Accession A0A4U0XYE5    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-30SSGTTQRKRGGGKKGKKHTPSDLWHydrophilic
NLS Segment(s)
PositionSequence
13-24RKRGGGKKGKKH
Subcellular Location(s) nucl 13, cyto 8, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MEEHAESSGTTQRKRGGGKKGKKHTPSDLWGPKSYYHWETLSSFEASLRHHIDNRIVDITPGGVETCELTFKPRSVFVIAHPAEASATTSTQSGDVQTIRDESSEFDKIEFSISVSEVLAIQDMSDRLKKQREIAKALVGIAEKVDGFKYSFRNNWNAKDEDGFRFSYQCNDSLQNKDRQANGLRLDAKAPYHGYGALEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.49
3 0.54
4 0.6
5 0.69
6 0.75
7 0.8
8 0.84
9 0.84
10 0.83
11 0.81
12 0.79
13 0.75
14 0.75
15 0.73
16 0.68
17 0.64
18 0.59
19 0.52
20 0.47
21 0.46
22 0.38
23 0.33
24 0.29
25 0.28
26 0.28
27 0.29
28 0.28
29 0.23
30 0.21
31 0.18
32 0.19
33 0.18
34 0.22
35 0.22
36 0.22
37 0.23
38 0.25
39 0.29
40 0.3
41 0.31
42 0.28
43 0.24
44 0.22
45 0.19
46 0.17
47 0.12
48 0.1
49 0.07
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.09
57 0.11
58 0.12
59 0.14
60 0.14
61 0.16
62 0.17
63 0.18
64 0.16
65 0.25
66 0.24
67 0.23
68 0.22
69 0.2
70 0.17
71 0.16
72 0.16
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.07
79 0.07
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.08
89 0.07
90 0.11
91 0.13
92 0.13
93 0.12
94 0.12
95 0.12
96 0.13
97 0.12
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.05
110 0.05
111 0.07
112 0.09
113 0.11
114 0.15
115 0.21
116 0.22
117 0.28
118 0.35
119 0.4
120 0.43
121 0.45
122 0.45
123 0.4
124 0.39
125 0.34
126 0.27
127 0.2
128 0.14
129 0.12
130 0.07
131 0.07
132 0.07
133 0.07
134 0.08
135 0.11
136 0.15
137 0.19
138 0.24
139 0.27
140 0.36
141 0.39
142 0.45
143 0.48
144 0.46
145 0.43
146 0.43
147 0.43
148 0.38
149 0.37
150 0.32
151 0.27
152 0.27
153 0.26
154 0.28
155 0.27
156 0.24
157 0.25
158 0.28
159 0.32
160 0.38
161 0.44
162 0.46
163 0.49
164 0.52
165 0.51
166 0.51
167 0.52
168 0.5
169 0.47
170 0.46
171 0.43
172 0.39
173 0.39
174 0.35
175 0.31
176 0.29
177 0.28
178 0.22
179 0.21
180 0.22