Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WTJ5

Protein Details
Accession A0A4U0WTJ5   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-54ASSKEHIKKLKQFKRELRVSKRELRRGLBasic
NLS Segment(s)
PositionSequence
34-48KKLKQFKRELRVSKR
Subcellular Location(s) cyto 11.5cyto_nucl 11.5, nucl 10.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022812  Dynamin  
IPR045063  Dynamin_N  
IPR000375  Dynamin_stalk  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF01031  Dynamin_M  
PF00350  Dynamin_N  
Amino Acid Sequences MHRSVNAETGYAVENTNGPSTPGSAEASSKEHIKKLKQFKRELRVSKRELRRGLLDVIVQANKIIFPSERPLRGFSKHILSIASCGPTKRPLQLVDLPGLIAYDNDGSGENKISLIRNLVIAQISKPQSTVLAVVRATDDINNNEILQHCAKYANKDRRTLGVITMPDLAPSEEANVYVKILKNGPTDFKFEHDWHVLKNRTHGEDTTSRKRNEAARQFFMESQVWCTVPAKNRGIFALRDRLRTILFSVAKRELPVLRNMIKERVAILGKEFQDLGRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.15
4 0.14
5 0.13
6 0.13
7 0.14
8 0.15
9 0.15
10 0.16
11 0.15
12 0.16
13 0.18
14 0.21
15 0.21
16 0.26
17 0.27
18 0.29
19 0.35
20 0.41
21 0.49
22 0.57
23 0.63
24 0.66
25 0.74
26 0.79
27 0.83
28 0.85
29 0.85
30 0.84
31 0.85
32 0.84
33 0.83
34 0.83
35 0.82
36 0.76
37 0.7
38 0.64
39 0.58
40 0.53
41 0.45
42 0.36
43 0.29
44 0.28
45 0.24
46 0.2
47 0.16
48 0.13
49 0.11
50 0.11
51 0.11
52 0.07
53 0.09
54 0.17
55 0.23
56 0.27
57 0.28
58 0.32
59 0.34
60 0.37
61 0.38
62 0.34
63 0.34
64 0.32
65 0.3
66 0.27
67 0.24
68 0.23
69 0.22
70 0.21
71 0.16
72 0.15
73 0.16
74 0.2
75 0.21
76 0.22
77 0.24
78 0.23
79 0.28
80 0.34
81 0.34
82 0.3
83 0.29
84 0.25
85 0.21
86 0.19
87 0.13
88 0.07
89 0.06
90 0.04
91 0.04
92 0.04
93 0.05
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.08
100 0.09
101 0.08
102 0.1
103 0.09
104 0.1
105 0.1
106 0.1
107 0.1
108 0.1
109 0.1
110 0.14
111 0.15
112 0.14
113 0.14
114 0.13
115 0.12
116 0.13
117 0.14
118 0.09
119 0.1
120 0.1
121 0.1
122 0.11
123 0.11
124 0.1
125 0.09
126 0.1
127 0.08
128 0.09
129 0.09
130 0.09
131 0.09
132 0.1
133 0.11
134 0.11
135 0.1
136 0.09
137 0.12
138 0.13
139 0.19
140 0.29
141 0.36
142 0.4
143 0.44
144 0.45
145 0.44
146 0.47
147 0.41
148 0.33
149 0.28
150 0.24
151 0.21
152 0.21
153 0.18
154 0.14
155 0.14
156 0.12
157 0.08
158 0.08
159 0.08
160 0.07
161 0.07
162 0.08
163 0.08
164 0.08
165 0.1
166 0.11
167 0.11
168 0.13
169 0.17
170 0.19
171 0.21
172 0.26
173 0.25
174 0.29
175 0.28
176 0.29
177 0.29
178 0.27
179 0.3
180 0.3
181 0.29
182 0.27
183 0.35
184 0.38
185 0.34
186 0.4
187 0.4
188 0.39
189 0.4
190 0.38
191 0.35
192 0.38
193 0.45
194 0.48
195 0.51
196 0.48
197 0.47
198 0.51
199 0.52
200 0.55
201 0.57
202 0.55
203 0.52
204 0.55
205 0.56
206 0.53
207 0.49
208 0.42
209 0.32
210 0.28
211 0.25
212 0.22
213 0.2
214 0.21
215 0.22
216 0.26
217 0.33
218 0.35
219 0.34
220 0.36
221 0.37
222 0.39
223 0.37
224 0.36
225 0.39
226 0.36
227 0.38
228 0.38
229 0.38
230 0.35
231 0.34
232 0.31
233 0.29
234 0.31
235 0.29
236 0.33
237 0.35
238 0.35
239 0.34
240 0.36
241 0.32
242 0.31
243 0.35
244 0.37
245 0.38
246 0.43
247 0.45
248 0.47
249 0.44
250 0.41
251 0.36
252 0.35
253 0.33
254 0.27
255 0.28
256 0.3
257 0.29
258 0.3
259 0.29
260 0.24