Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XCT8

Protein Details
Accession A0A4U0XCT8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGGKKHKKKWSKGKVKDKANHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GGKKHKKKWSKGKVKDK
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGGKKHKKKWSKGKVKDKANHAVILDKNTSDKLQKDVQSYRLITVATLVDRLKINGSLARKALADLEEKGQIKKVVGHSKLSIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.88
3 0.89
4 0.92
5 0.92
6 0.92
7 0.89
8 0.85
9 0.83
10 0.74
11 0.66
12 0.56
13 0.52
14 0.43
15 0.4
16 0.33
17 0.24
18 0.22
19 0.2
20 0.21
21 0.18
22 0.17
23 0.17
24 0.22
25 0.25
26 0.29
27 0.31
28 0.34
29 0.36
30 0.35
31 0.32
32 0.27
33 0.23
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.12
47 0.14
48 0.15
49 0.16
50 0.17
51 0.16
52 0.15
53 0.16
54 0.14
55 0.14
56 0.13
57 0.15
58 0.2
59 0.2
60 0.21
61 0.22
62 0.22
63 0.21
64 0.25
65 0.31
66 0.35
67 0.37
68 0.4
69 0.4
70 0.42
71 0.47
72 0.44
73 0.39
74 0.31
75 0.31
76 0.28