Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0WRS6

Protein Details
Accession A0A4U0WRS6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKSGKKNQIKFKVRCHRYHydrophilic
NLS Segment(s)
PositionSequence
23-32ARIKKSGKKN
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPSEVSDIKQFIEICRRKDASSARIKKSGKKNQIKFKVRCHRYLYTLVLKDSDKAEKLKQSLPPGLTITDTPKKNQKGKRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.43
4 0.39
5 0.45
6 0.48
7 0.47
8 0.53
9 0.58
10 0.54
11 0.6
12 0.62
13 0.63
14 0.68
15 0.69
16 0.69
17 0.71
18 0.74
19 0.77
20 0.86
21 0.87
22 0.81
23 0.82
24 0.82
25 0.75
26 0.73
27 0.69
28 0.61
29 0.55
30 0.54
31 0.48
32 0.44
33 0.42
34 0.36
35 0.32
36 0.29
37 0.26
38 0.24
39 0.22
40 0.17
41 0.18
42 0.21
43 0.24
44 0.27
45 0.31
46 0.34
47 0.37
48 0.41
49 0.39
50 0.39
51 0.35
52 0.33
53 0.29
54 0.25
55 0.27
56 0.29
57 0.3
58 0.32
59 0.39
60 0.47
61 0.55
62 0.62