Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FZ88

Protein Details
Accession C5FZ88    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
171-199QAESEKRKRGATKGRGRRTKHPKLAVEKGBasic
NLS Segment(s)
PositionSequence
175-199EKRKRGATKGRGRRTKHPKLAVEKG
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MSAIRRYLTAEKTARIMEWVDTVNSQPCIGMTVREPSKAAKRTDITSSAAIPPKAGMGRPPKYKQLTLKSTKLRRVSVVPRGSRQQDEQKEEKAADGEKEHVNEENGIAQLETKYGEETKDKEVKEEKSEQAMPRNPIPSVVESNLRMFCVEIVIPSSGKHSSRDKEAINQAESEKRKRGATKGRGRRTKHPKLAVEKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.27
4 0.2
5 0.19
6 0.19
7 0.17
8 0.16
9 0.18
10 0.2
11 0.19
12 0.18
13 0.14
14 0.13
15 0.14
16 0.14
17 0.14
18 0.12
19 0.2
20 0.22
21 0.23
22 0.24
23 0.26
24 0.35
25 0.4
26 0.4
27 0.39
28 0.4
29 0.42
30 0.46
31 0.45
32 0.39
33 0.34
34 0.33
35 0.31
36 0.32
37 0.29
38 0.24
39 0.21
40 0.2
41 0.19
42 0.18
43 0.19
44 0.24
45 0.31
46 0.39
47 0.43
48 0.48
49 0.52
50 0.57
51 0.59
52 0.59
53 0.61
54 0.6
55 0.65
56 0.66
57 0.68
58 0.7
59 0.67
60 0.59
61 0.52
62 0.53
63 0.51
64 0.51
65 0.52
66 0.48
67 0.46
68 0.48
69 0.48
70 0.44
71 0.41
72 0.41
73 0.4
74 0.43
75 0.43
76 0.41
77 0.39
78 0.37
79 0.33
80 0.25
81 0.19
82 0.14
83 0.12
84 0.13
85 0.12
86 0.13
87 0.13
88 0.13
89 0.12
90 0.11
91 0.1
92 0.09
93 0.08
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.06
102 0.06
103 0.08
104 0.1
105 0.12
106 0.19
107 0.24
108 0.23
109 0.27
110 0.31
111 0.33
112 0.37
113 0.4
114 0.35
115 0.35
116 0.4
117 0.38
118 0.41
119 0.43
120 0.41
121 0.39
122 0.39
123 0.34
124 0.31
125 0.31
126 0.26
127 0.25
128 0.23
129 0.23
130 0.22
131 0.26
132 0.25
133 0.23
134 0.19
135 0.15
136 0.14
137 0.12
138 0.1
139 0.08
140 0.09
141 0.1
142 0.1
143 0.1
144 0.13
145 0.14
146 0.16
147 0.19
148 0.25
149 0.27
150 0.35
151 0.4
152 0.4
153 0.45
154 0.52
155 0.53
156 0.47
157 0.46
158 0.41
159 0.44
160 0.47
161 0.45
162 0.43
163 0.4
164 0.45
165 0.48
166 0.55
167 0.58
168 0.63
169 0.69
170 0.73
171 0.81
172 0.84
173 0.85
174 0.86
175 0.86
176 0.87
177 0.86
178 0.85
179 0.83