Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0V3T5

Protein Details
Accession A0A4U0V3T5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
91-117TCNGNFNKYYKKPKCKSNQGSGKTKTLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, vacu 2
Family & Domain DBs
Amino Acid Sequences MKVTSIGLTLLLSIGLVSALPRLAARADDPCYCVDYENDDNGKKYGGSYDLCTAPFDTYYPKPRYSSSDTCYVTEYQTDDCGYEYGGAYNTCNGNFNKYYKKPKCKSNQGSGKTKTLISST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.06
11 0.07
12 0.09
13 0.13
14 0.16
15 0.17
16 0.19
17 0.19
18 0.2
19 0.19
20 0.18
21 0.15
22 0.18
23 0.19
24 0.23
25 0.25
26 0.24
27 0.24
28 0.24
29 0.24
30 0.17
31 0.15
32 0.11
33 0.11
34 0.12
35 0.13
36 0.15
37 0.16
38 0.17
39 0.17
40 0.16
41 0.13
42 0.12
43 0.11
44 0.12
45 0.14
46 0.22
47 0.24
48 0.25
49 0.26
50 0.28
51 0.33
52 0.37
53 0.4
54 0.35
55 0.4
56 0.4
57 0.39
58 0.4
59 0.34
60 0.27
61 0.22
62 0.2
63 0.12
64 0.12
65 0.12
66 0.1
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.07
73 0.09
74 0.09
75 0.08
76 0.11
77 0.12
78 0.11
79 0.15
80 0.15
81 0.2
82 0.23
83 0.27
84 0.35
85 0.41
86 0.53
87 0.59
88 0.7
89 0.7
90 0.77
91 0.83
92 0.85
93 0.86
94 0.86
95 0.86
96 0.83
97 0.87
98 0.82
99 0.78
100 0.69
101 0.61