Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XCG1

Protein Details
Accession A0A4U0XCG1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-126DDDEKVRKKPPPLRRSKRAWSCFGCHydrophilic
NLS Segment(s)
PositionSequence
107-119VRKKPPPLRRSKR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MPQRPTSLPPDALSYPLANEEAQFRCPIPATTIHWTSPSTRKQEYAEIDKRTRGFRGLWRKTAPKWCMSSPQRFYNEKDSDAGSVRRYRLETPDDEDADEEDDDEKVRKKPPPLRRSKRAWSCFGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.2
3 0.19
4 0.19
5 0.13
6 0.13
7 0.16
8 0.16
9 0.17
10 0.17
11 0.16
12 0.17
13 0.18
14 0.18
15 0.16
16 0.18
17 0.22
18 0.27
19 0.29
20 0.28
21 0.29
22 0.29
23 0.31
24 0.34
25 0.35
26 0.35
27 0.34
28 0.36
29 0.36
30 0.42
31 0.43
32 0.44
33 0.45
34 0.45
35 0.45
36 0.46
37 0.45
38 0.41
39 0.36
40 0.29
41 0.25
42 0.27
43 0.37
44 0.39
45 0.43
46 0.45
47 0.47
48 0.5
49 0.56
50 0.5
51 0.44
52 0.42
53 0.38
54 0.44
55 0.46
56 0.5
57 0.46
58 0.51
59 0.52
60 0.51
61 0.53
62 0.53
63 0.5
64 0.42
65 0.38
66 0.32
67 0.28
68 0.28
69 0.26
70 0.2
71 0.22
72 0.22
73 0.23
74 0.24
75 0.25
76 0.27
77 0.3
78 0.29
79 0.3
80 0.35
81 0.33
82 0.31
83 0.3
84 0.25
85 0.22
86 0.19
87 0.15
88 0.09
89 0.09
90 0.09
91 0.11
92 0.14
93 0.16
94 0.22
95 0.27
96 0.36
97 0.46
98 0.56
99 0.65
100 0.73
101 0.8
102 0.83
103 0.87
104 0.89
105 0.9
106 0.87