Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WTF0

Protein Details
Accession A0A4U0WTF0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-73TDERARKLWGRRAGKKKLPGLBasic
NLS Segment(s)
PositionSequence
57-71ARKLWGRRAGKKKLP
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, cysk 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Amino Acid Sequences MDSIDISSYDSDPTLYLFTSLTAGSSHIISATSRMETILKANRIPFLAIDTATDERARKLWGRRAGKKKLPGLVKEGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.08
6 0.09
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.07
13 0.07
14 0.06
15 0.07
16 0.06
17 0.07
18 0.08
19 0.07
20 0.07
21 0.08
22 0.08
23 0.08
24 0.12
25 0.15
26 0.16
27 0.17
28 0.17
29 0.18
30 0.18
31 0.18
32 0.15
33 0.12
34 0.11
35 0.1
36 0.1
37 0.12
38 0.12
39 0.13
40 0.14
41 0.12
42 0.12
43 0.14
44 0.16
45 0.19
46 0.25
47 0.34
48 0.42
49 0.52
50 0.61
51 0.7
52 0.77
53 0.8
54 0.82
55 0.8
56 0.78
57 0.76
58 0.69