Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V5NKQ4

Protein Details
Accession A0A4V5NKQ4    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-37DGERCDNKSRREQRTLKPLYAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7cyto_nucl 7pero 7, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001279  Metallo-B-lactamas  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Pfam View protein in Pfam  
PF00753  Lactamase_B  
Amino Acid Sequences MQTAERDGERWREMERDGERCDNKSRREQRTLKPLYADRPFSALLLSNLTRLDDAAAAAAAAAATGTKETTGKRLVTPAKARRPALQSGLDVFLDRKDVEIWVHDKELRSAFWSVATGADVGVYMKHYLQLDLNWKTFDERTIDFCQGITLHHLPGHTDGLIGMQINLPDSGTFLFISDHCHVIENWRDGIPQGWLARDHPAWFNSTQRLKRLEATTRGRVIPGHDKETFLQLQSEGPEWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.37
4 0.4
5 0.48
6 0.49
7 0.49
8 0.58
9 0.56
10 0.57
11 0.62
12 0.67
13 0.66
14 0.74
15 0.79
16 0.78
17 0.82
18 0.82
19 0.74
20 0.71
21 0.67
22 0.64
23 0.62
24 0.57
25 0.47
26 0.44
27 0.41
28 0.33
29 0.3
30 0.24
31 0.18
32 0.18
33 0.18
34 0.16
35 0.15
36 0.16
37 0.15
38 0.13
39 0.13
40 0.08
41 0.08
42 0.06
43 0.06
44 0.05
45 0.05
46 0.05
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.04
55 0.06
56 0.07
57 0.11
58 0.15
59 0.17
60 0.17
61 0.25
62 0.28
63 0.34
64 0.43
65 0.48
66 0.54
67 0.59
68 0.59
69 0.58
70 0.58
71 0.54
72 0.49
73 0.43
74 0.34
75 0.3
76 0.3
77 0.24
78 0.2
79 0.17
80 0.12
81 0.11
82 0.1
83 0.09
84 0.07
85 0.08
86 0.08
87 0.1
88 0.12
89 0.12
90 0.14
91 0.15
92 0.15
93 0.16
94 0.17
95 0.15
96 0.15
97 0.14
98 0.13
99 0.12
100 0.12
101 0.1
102 0.08
103 0.08
104 0.06
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.06
114 0.07
115 0.07
116 0.08
117 0.1
118 0.16
119 0.19
120 0.2
121 0.18
122 0.18
123 0.2
124 0.19
125 0.19
126 0.15
127 0.13
128 0.18
129 0.21
130 0.22
131 0.2
132 0.2
133 0.19
134 0.16
135 0.15
136 0.15
137 0.12
138 0.12
139 0.13
140 0.13
141 0.13
142 0.15
143 0.16
144 0.11
145 0.09
146 0.09
147 0.08
148 0.09
149 0.08
150 0.06
151 0.06
152 0.06
153 0.07
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.07
160 0.07
161 0.06
162 0.07
163 0.07
164 0.14
165 0.14
166 0.15
167 0.14
168 0.16
169 0.15
170 0.2
171 0.26
172 0.23
173 0.24
174 0.23
175 0.23
176 0.22
177 0.23
178 0.2
179 0.18
180 0.16
181 0.16
182 0.17
183 0.18
184 0.23
185 0.23
186 0.23
187 0.22
188 0.22
189 0.24
190 0.25
191 0.28
192 0.32
193 0.39
194 0.41
195 0.44
196 0.47
197 0.47
198 0.52
199 0.54
200 0.54
201 0.54
202 0.58
203 0.59
204 0.6
205 0.58
206 0.52
207 0.46
208 0.44
209 0.45
210 0.43
211 0.41
212 0.38
213 0.4
214 0.4
215 0.46
216 0.41
217 0.32
218 0.28
219 0.22
220 0.24
221 0.23