Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WTQ2

Protein Details
Accession A0A4U0WTQ2    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
336-359EEAPVAKKAKKSRKISNAQHRTADHydrophilic
NLS Segment(s)
PositionSequence
342-349KKAKKSRK
Subcellular Location(s) nucl 14.5, cyto_nucl 14, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004000  Actin  
IPR043129  ATPase_NBD  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF00022  Actin  
PF14615  Rsa3  
Amino Acid Sequences MESLDDAEKPMSQNPLLMTEPGWNTTKSREKAVEIAMEDWGCPAFYVGKSRVLAAFAAGKATALVVDVGASTMSVTPVTDGLVLKKGIQKSPFAGNFISSQIRLIFAQSTPPVPLVPHYMVKSKAPIDAGAPSQATFVKFDKPPAASFRRLEEERVLTEFKESIVRIWPGPGKFAQNEEAARAAPGQPFEMPDGWNNVFGAERYKAAEGLFDHKAALVDADNPAPKAEQTISAMINASLASVDVELRPHLLANIVVTGGSSLIYGFNDRLHRELEHMFPNPRIRVTAPSSISSDSSSDSEADADAQTSAPAAASSSAEPVSVADGEVRAVEVAGEEEAPVAKKAKKSRKISNAQHRTADAQEQPESPTDSATPAPARSSNQLEPDAEEAFQQFYLRQVTAEFAEDLDKIRAAGDFSDRALPVLVGALRQGTACFSAEERRRVGRAAVTAATVERGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.26
4 0.25
5 0.22
6 0.24
7 0.25
8 0.26
9 0.27
10 0.23
11 0.24
12 0.31
13 0.4
14 0.37
15 0.42
16 0.43
17 0.44
18 0.49
19 0.52
20 0.49
21 0.41
22 0.39
23 0.35
24 0.31
25 0.27
26 0.22
27 0.18
28 0.12
29 0.1
30 0.1
31 0.1
32 0.12
33 0.18
34 0.2
35 0.27
36 0.27
37 0.29
38 0.29
39 0.27
40 0.25
41 0.2
42 0.22
43 0.16
44 0.16
45 0.15
46 0.13
47 0.12
48 0.12
49 0.1
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.07
66 0.09
67 0.09
68 0.11
69 0.15
70 0.15
71 0.17
72 0.22
73 0.25
74 0.28
75 0.3
76 0.31
77 0.3
78 0.39
79 0.39
80 0.36
81 0.33
82 0.29
83 0.28
84 0.29
85 0.27
86 0.18
87 0.17
88 0.15
89 0.16
90 0.14
91 0.14
92 0.13
93 0.11
94 0.16
95 0.16
96 0.17
97 0.16
98 0.16
99 0.15
100 0.14
101 0.15
102 0.16
103 0.18
104 0.21
105 0.22
106 0.26
107 0.27
108 0.28
109 0.31
110 0.27
111 0.26
112 0.23
113 0.22
114 0.19
115 0.2
116 0.2
117 0.18
118 0.17
119 0.14
120 0.14
121 0.15
122 0.14
123 0.14
124 0.14
125 0.18
126 0.18
127 0.21
128 0.25
129 0.25
130 0.27
131 0.32
132 0.36
133 0.36
134 0.36
135 0.37
136 0.4
137 0.39
138 0.39
139 0.35
140 0.33
141 0.29
142 0.3
143 0.27
144 0.2
145 0.21
146 0.18
147 0.14
148 0.15
149 0.14
150 0.12
151 0.16
152 0.17
153 0.16
154 0.19
155 0.22
156 0.19
157 0.21
158 0.22
159 0.21
160 0.21
161 0.23
162 0.23
163 0.21
164 0.21
165 0.2
166 0.19
167 0.15
168 0.15
169 0.13
170 0.12
171 0.1
172 0.1
173 0.1
174 0.09
175 0.1
176 0.12
177 0.12
178 0.11
179 0.11
180 0.16
181 0.15
182 0.15
183 0.14
184 0.13
185 0.12
186 0.11
187 0.13
188 0.09
189 0.09
190 0.1
191 0.1
192 0.11
193 0.1
194 0.12
195 0.1
196 0.14
197 0.14
198 0.13
199 0.13
200 0.12
201 0.12
202 0.1
203 0.1
204 0.06
205 0.05
206 0.06
207 0.08
208 0.08
209 0.08
210 0.08
211 0.08
212 0.07
213 0.08
214 0.08
215 0.08
216 0.09
217 0.11
218 0.12
219 0.12
220 0.12
221 0.1
222 0.1
223 0.08
224 0.06
225 0.04
226 0.03
227 0.03
228 0.03
229 0.04
230 0.04
231 0.04
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.05
238 0.05
239 0.05
240 0.05
241 0.05
242 0.04
243 0.04
244 0.04
245 0.04
246 0.04
247 0.03
248 0.03
249 0.03
250 0.04
251 0.05
252 0.05
253 0.09
254 0.11
255 0.12
256 0.13
257 0.14
258 0.15
259 0.17
260 0.19
261 0.19
262 0.21
263 0.23
264 0.23
265 0.25
266 0.3
267 0.28
268 0.26
269 0.25
270 0.22
271 0.24
272 0.28
273 0.31
274 0.28
275 0.29
276 0.3
277 0.3
278 0.29
279 0.24
280 0.2
281 0.14
282 0.13
283 0.12
284 0.11
285 0.1
286 0.09
287 0.08
288 0.09
289 0.07
290 0.07
291 0.06
292 0.06
293 0.06
294 0.05
295 0.05
296 0.04
297 0.04
298 0.04
299 0.04
300 0.05
301 0.06
302 0.07
303 0.08
304 0.08
305 0.08
306 0.07
307 0.08
308 0.07
309 0.07
310 0.06
311 0.06
312 0.06
313 0.06
314 0.06
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.04
321 0.04
322 0.04
323 0.04
324 0.05
325 0.06
326 0.07
327 0.1
328 0.13
329 0.19
330 0.29
331 0.4
332 0.49
333 0.57
334 0.66
335 0.73
336 0.81
337 0.86
338 0.87
339 0.87
340 0.82
341 0.77
342 0.68
343 0.6
344 0.52
345 0.47
346 0.39
347 0.33
348 0.31
349 0.28
350 0.28
351 0.27
352 0.28
353 0.23
354 0.21
355 0.17
356 0.17
357 0.16
358 0.18
359 0.18
360 0.16
361 0.18
362 0.2
363 0.22
364 0.25
365 0.31
366 0.32
367 0.34
368 0.36
369 0.34
370 0.34
371 0.33
372 0.29
373 0.23
374 0.2
375 0.16
376 0.14
377 0.13
378 0.12
379 0.09
380 0.12
381 0.15
382 0.14
383 0.14
384 0.13
385 0.15
386 0.16
387 0.18
388 0.15
389 0.12
390 0.14
391 0.14
392 0.16
393 0.15
394 0.14
395 0.11
396 0.12
397 0.12
398 0.11
399 0.13
400 0.15
401 0.16
402 0.17
403 0.22
404 0.21
405 0.21
406 0.21
407 0.18
408 0.14
409 0.16
410 0.15
411 0.1
412 0.11
413 0.11
414 0.11
415 0.11
416 0.11
417 0.09
418 0.11
419 0.12
420 0.12
421 0.14
422 0.23
423 0.3
424 0.35
425 0.38
426 0.41
427 0.42
428 0.43
429 0.45
430 0.42
431 0.39
432 0.38
433 0.35
434 0.3
435 0.3
436 0.28