Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FNU3

Protein Details
Accession C5FNU3    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-58TDARLRGIRRRQARNEKFEEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences MATKLTSCRPLLCQATGLTPLVSCRYNSGFGGITLSPATDARLRGIRRRQARNEKFEEERAREQRIIDLQKQQTRSWQAGDVYSPRDLSPAEMKKWRKRQSPSTDIFDALSLNPLHMYKNFAVMSEYVSETGRIKPARETGLRRVNQRKLSKAIRRAVSMGLMPSVHRHPEILMLEKKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.32
4 0.29
5 0.21
6 0.17
7 0.17
8 0.17
9 0.17
10 0.15
11 0.16
12 0.19
13 0.21
14 0.21
15 0.22
16 0.2
17 0.18
18 0.22
19 0.18
20 0.16
21 0.13
22 0.13
23 0.11
24 0.1
25 0.12
26 0.11
27 0.12
28 0.14
29 0.2
30 0.23
31 0.3
32 0.39
33 0.45
34 0.52
35 0.61
36 0.68
37 0.73
38 0.8
39 0.8
40 0.78
41 0.75
42 0.69
43 0.68
44 0.64
45 0.58
46 0.58
47 0.53
48 0.5
49 0.46
50 0.43
51 0.39
52 0.39
53 0.38
54 0.33
55 0.37
56 0.39
57 0.42
58 0.44
59 0.41
60 0.4
61 0.39
62 0.37
63 0.31
64 0.28
65 0.24
66 0.22
67 0.23
68 0.19
69 0.17
70 0.16
71 0.15
72 0.12
73 0.12
74 0.11
75 0.11
76 0.17
77 0.19
78 0.21
79 0.28
80 0.34
81 0.42
82 0.52
83 0.58
84 0.58
85 0.62
86 0.69
87 0.72
88 0.75
89 0.72
90 0.68
91 0.61
92 0.53
93 0.46
94 0.36
95 0.27
96 0.17
97 0.16
98 0.1
99 0.08
100 0.09
101 0.09
102 0.1
103 0.1
104 0.14
105 0.11
106 0.17
107 0.17
108 0.16
109 0.17
110 0.17
111 0.18
112 0.15
113 0.15
114 0.11
115 0.11
116 0.12
117 0.12
118 0.13
119 0.18
120 0.17
121 0.18
122 0.2
123 0.25
124 0.3
125 0.35
126 0.4
127 0.44
128 0.52
129 0.55
130 0.6
131 0.65
132 0.66
133 0.7
134 0.71
135 0.67
136 0.66
137 0.72
138 0.73
139 0.73
140 0.73
141 0.68
142 0.65
143 0.6
144 0.54
145 0.46
146 0.39
147 0.31
148 0.24
149 0.2
150 0.17
151 0.19
152 0.21
153 0.21
154 0.2
155 0.19
156 0.18
157 0.25
158 0.29
159 0.33