Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0VR20

Protein Details
Accession A0A4U0VR20    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-31LSEAERKLVKRRKAKVSHCPASNHydrophilic
NLS Segment(s)
PositionSequence
18-21KRRK
Subcellular Location(s) mito 15, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR006680  Amidohydro-rel  
IPR011059  Metal-dep_hydrolase_composite  
IPR032466  Metal_Hydrolase  
Gene Ontology GO:0016810  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds  
Pfam View protein in Pfam  
PF01979  Amidohydro_1  
Amino Acid Sequences TILAHAVHLSEAERKLVKRRKAKVSHCPASNTALTSGCARVRELWDAGITVGLGTDVSGGYSASVLEAARQAIMVSRHVAMTEGDGAKLSTEEVLYLATRGGAEVVGLEDKIGAFEVGMQWDAQLVGLGEVAKGEEGKIGEDGPVDVFGWEQWEERVAKWLYNGDDRNTKAVWVKGRLVHYRPEMEHRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.34
3 0.43
4 0.5
5 0.55
6 0.63
7 0.7
8 0.77
9 0.84
10 0.85
11 0.86
12 0.86
13 0.8
14 0.75
15 0.67
16 0.61
17 0.54
18 0.44
19 0.35
20 0.28
21 0.25
22 0.21
23 0.22
24 0.19
25 0.18
26 0.17
27 0.19
28 0.2
29 0.23
30 0.22
31 0.2
32 0.18
33 0.18
34 0.17
35 0.13
36 0.1
37 0.06
38 0.05
39 0.04
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.07
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.1
67 0.08
68 0.08
69 0.1
70 0.09
71 0.08
72 0.09
73 0.08
74 0.08
75 0.08
76 0.07
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.06
124 0.07
125 0.07
126 0.08
127 0.08
128 0.08
129 0.08
130 0.07
131 0.08
132 0.07
133 0.06
134 0.06
135 0.06
136 0.08
137 0.09
138 0.09
139 0.08
140 0.12
141 0.13
142 0.13
143 0.21
144 0.19
145 0.2
146 0.21
147 0.26
148 0.26
149 0.33
150 0.35
151 0.32
152 0.39
153 0.4
154 0.41
155 0.37
156 0.35
157 0.32
158 0.35
159 0.37
160 0.35
161 0.39
162 0.41
163 0.48
164 0.54
165 0.52
166 0.54
167 0.54
168 0.55
169 0.53