Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0U966

Protein Details
Accession A0A4U0U966    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MDKVWDERRKIKEERRREQKANVEKKRKERGABasic
NLS Segment(s)
PositionSequence
8-30RRKIKEERRREQKANVEKKRKER
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MDKVWDERRKIKEERRREQKANVEKKRKERGATDGEAGEDYDLDDEDLDMDDDEWNSEGLDEAGDGEDEDIEGDEEVEEEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.82
5 0.81
6 0.81
7 0.81
8 0.81
9 0.81
10 0.81
11 0.78
12 0.83
13 0.84
14 0.8
15 0.73
16 0.65
17 0.62
18 0.59
19 0.54
20 0.47
21 0.37
22 0.32
23 0.28
24 0.24
25 0.16
26 0.08
27 0.06
28 0.04
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.04
54 0.04
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05