Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5NIY8

Protein Details
Accession A0A4V5NIY8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
280-305LCCCCASRRDVRTGRKRGSRKAWEGAHydrophilic
NLS Segment(s)
PositionSequence
291-332RTGRKRGSRKAWEGAGLAPPPGVVAEKKSSSKEGRSVFGRKK
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MAFGRKKASVGPDLPSPSPSAETDRTLTTTVPYGSQDIPKPVLKRATRTRKAFAVLTSLCLLVSVVFMVLVEIGNTYDRKVLTDIYFLRIDLTNVVPSAVPNARLLNSIARSLGLHDFYTAGLWGFCEGYNDEGTTFCSKPQTLYWFNPVEILLNELLAGATIALPAELITYLNILKTAYQWMFGFFLSGTCLAALLIPLTPLSVFSRLTTLPIALFTFLAALLITAATVLATVMFIIIRNAVTGVAALNIGATLGLEMFVFMWIAAGFSLVAALVQLGLCCCCASRRDVRTGRKRGSRKAWEGAGLAPPPGVVAEKKSSSKEGRSVFGRKKAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.36
4 0.29
5 0.29
6 0.27
7 0.27
8 0.26
9 0.28
10 0.29
11 0.3
12 0.3
13 0.29
14 0.27
15 0.22
16 0.23
17 0.2
18 0.19
19 0.19
20 0.2
21 0.21
22 0.26
23 0.28
24 0.28
25 0.32
26 0.35
27 0.36
28 0.38
29 0.45
30 0.43
31 0.49
32 0.56
33 0.63
34 0.67
35 0.72
36 0.71
37 0.67
38 0.67
39 0.61
40 0.51
41 0.49
42 0.39
43 0.36
44 0.32
45 0.26
46 0.22
47 0.19
48 0.17
49 0.09
50 0.08
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.06
62 0.07
63 0.08
64 0.1
65 0.1
66 0.12
67 0.13
68 0.16
69 0.15
70 0.22
71 0.22
72 0.23
73 0.24
74 0.22
75 0.23
76 0.2
77 0.19
78 0.15
79 0.15
80 0.12
81 0.11
82 0.12
83 0.1
84 0.09
85 0.14
86 0.13
87 0.13
88 0.13
89 0.14
90 0.14
91 0.15
92 0.17
93 0.17
94 0.17
95 0.17
96 0.15
97 0.14
98 0.14
99 0.15
100 0.16
101 0.13
102 0.12
103 0.11
104 0.11
105 0.11
106 0.11
107 0.09
108 0.06
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.06
115 0.07
116 0.08
117 0.09
118 0.09
119 0.09
120 0.08
121 0.11
122 0.13
123 0.13
124 0.12
125 0.14
126 0.14
127 0.15
128 0.18
129 0.23
130 0.24
131 0.26
132 0.31
133 0.3
134 0.3
135 0.29
136 0.26
137 0.2
138 0.15
139 0.15
140 0.09
141 0.07
142 0.07
143 0.06
144 0.06
145 0.04
146 0.04
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.03
157 0.03
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.05
165 0.09
166 0.08
167 0.1
168 0.1
169 0.11
170 0.12
171 0.12
172 0.12
173 0.07
174 0.08
175 0.07
176 0.07
177 0.06
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.03
186 0.04
187 0.04
188 0.04
189 0.05
190 0.06
191 0.08
192 0.08
193 0.08
194 0.11
195 0.11
196 0.13
197 0.12
198 0.11
199 0.09
200 0.1
201 0.1
202 0.08
203 0.08
204 0.06
205 0.06
206 0.05
207 0.05
208 0.04
209 0.03
210 0.03
211 0.03
212 0.03
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.02
222 0.03
223 0.03
224 0.03
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.03
238 0.03
239 0.03
240 0.03
241 0.02
242 0.02
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.04
250 0.04
251 0.04
252 0.04
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.03
264 0.04
265 0.04
266 0.05
267 0.05
268 0.06
269 0.06
270 0.08
271 0.1
272 0.16
273 0.25
274 0.31
275 0.41
276 0.5
277 0.61
278 0.69
279 0.77
280 0.8
281 0.81
282 0.83
283 0.83
284 0.85
285 0.84
286 0.81
287 0.79
288 0.73
289 0.67
290 0.6
291 0.53
292 0.48
293 0.38
294 0.31
295 0.23
296 0.19
297 0.16
298 0.15
299 0.14
300 0.09
301 0.14
302 0.2
303 0.25
304 0.29
305 0.32
306 0.39
307 0.43
308 0.49
309 0.52
310 0.5
311 0.51
312 0.55
313 0.61
314 0.62
315 0.65