Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0UMI4

Protein Details
Accession A0A4U0UMI4    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MVKKRASNGRNKKGRGHVKPIRCSNCHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
Subcellular Location(s) mito_nucl 12.333, nucl 12, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MVKKRASNGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFPEYTVPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.77
4 0.74
5 0.74
6 0.8
7 0.81
8 0.77
9 0.69
10 0.68
11 0.65
12 0.65
13 0.63
14 0.6
15 0.57
16 0.58
17 0.61
18 0.62
19 0.65
20 0.63
21 0.65
22 0.66
23 0.68
24 0.64
25 0.66
26 0.61
27 0.62
28 0.55
29 0.48
30 0.43
31 0.35
32 0.33
33 0.27
34 0.26
35 0.17
36 0.16
37 0.14
38 0.12
39 0.12
40 0.11
41 0.11
42 0.08
43 0.09
44 0.12
45 0.12
46 0.12