Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0X7X7

Protein Details
Accession A0A4U0X7X7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
162-182EQKVWDRERKKTKVEKGEEEEAcidic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 12.333, cyto 7, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR025494  DUF4385  
Pfam View protein in Pfam  
PF14328  DUF4385  
Amino Acid Sequences MASAATDKALRMSYRIGRGEQGVLTFEPYKSALLPLWRFRTVAIAKQSSAELWARFVAYDDAADFVGMDMCRKFVQMGMTRAKRYANHKGGRKYVKGTPVAVKSESGNGQRYVRGTGVELPKGEDFAGREEKLRASEVFKKVWVRCREHEGYVRRKEEFLAEQKVWDRERKKTKVEKGEEEEVQVKEEVKVEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.37
4 0.36
5 0.38
6 0.38
7 0.32
8 0.27
9 0.21
10 0.18
11 0.2
12 0.2
13 0.17
14 0.16
15 0.16
16 0.16
17 0.14
18 0.15
19 0.14
20 0.2
21 0.25
22 0.31
23 0.35
24 0.36
25 0.35
26 0.34
27 0.41
28 0.35
29 0.37
30 0.37
31 0.34
32 0.33
33 0.34
34 0.34
35 0.25
36 0.25
37 0.21
38 0.14
39 0.13
40 0.14
41 0.13
42 0.12
43 0.13
44 0.12
45 0.09
46 0.09
47 0.07
48 0.08
49 0.07
50 0.07
51 0.06
52 0.05
53 0.07
54 0.06
55 0.07
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.15
63 0.19
64 0.25
65 0.32
66 0.36
67 0.36
68 0.37
69 0.38
70 0.35
71 0.36
72 0.41
73 0.42
74 0.45
75 0.51
76 0.55
77 0.61
78 0.63
79 0.58
80 0.52
81 0.46
82 0.46
83 0.41
84 0.38
85 0.34
86 0.32
87 0.32
88 0.29
89 0.25
90 0.19
91 0.2
92 0.21
93 0.19
94 0.18
95 0.18
96 0.18
97 0.19
98 0.19
99 0.19
100 0.16
101 0.14
102 0.12
103 0.17
104 0.19
105 0.19
106 0.19
107 0.19
108 0.19
109 0.19
110 0.18
111 0.13
112 0.11
113 0.13
114 0.18
115 0.17
116 0.18
117 0.19
118 0.2
119 0.2
120 0.22
121 0.18
122 0.18
123 0.27
124 0.29
125 0.29
126 0.31
127 0.37
128 0.39
129 0.47
130 0.5
131 0.48
132 0.49
133 0.56
134 0.56
135 0.55
136 0.59
137 0.58
138 0.6
139 0.62
140 0.62
141 0.54
142 0.51
143 0.47
144 0.44
145 0.42
146 0.4
147 0.38
148 0.35
149 0.37
150 0.41
151 0.45
152 0.43
153 0.44
154 0.41
155 0.44
156 0.55
157 0.59
158 0.65
159 0.69
160 0.77
161 0.79
162 0.83
163 0.82
164 0.79
165 0.79
166 0.7
167 0.64
168 0.6
169 0.49
170 0.43
171 0.34
172 0.28
173 0.22
174 0.24