Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FXA8

Protein Details
Accession C5FXA8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
3-23IEMSRRNKKPRPVLESEKQELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000789  Cyclin-dep_kinase_reg-sub  
IPR036858  Cyclin-dep_kinase_reg-sub_sf  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0016301  F:kinase activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF01111  CKS  
PROSITE View protein in PROSITE  
PS00945  CKS_2  
Amino Acid Sequences MDIEMSRRNKKPRPVLESEKQELGEFAEGIHYSPRYSDSEYEYRHVQLPKPMLKKIPNEYFDHAKGTLKLLWEEEWRGLGITQSLGWEHYEVHEPEPHILLFKRPVNYKPPVSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.8
4 0.81
5 0.75
6 0.67
7 0.58
8 0.49
9 0.4
10 0.33
11 0.24
12 0.15
13 0.11
14 0.11
15 0.1
16 0.1
17 0.12
18 0.1
19 0.09
20 0.1
21 0.12
22 0.13
23 0.15
24 0.17
25 0.21
26 0.27
27 0.29
28 0.31
29 0.3
30 0.28
31 0.3
32 0.3
33 0.26
34 0.24
35 0.29
36 0.34
37 0.36
38 0.36
39 0.36
40 0.39
41 0.43
42 0.46
43 0.47
44 0.42
45 0.42
46 0.44
47 0.43
48 0.39
49 0.36
50 0.29
51 0.23
52 0.2
53 0.19
54 0.18
55 0.14
56 0.14
57 0.13
58 0.14
59 0.15
60 0.16
61 0.14
62 0.13
63 0.12
64 0.12
65 0.11
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.08
74 0.08
75 0.08
76 0.09
77 0.15
78 0.15
79 0.18
80 0.2
81 0.21
82 0.22
83 0.24
84 0.22
85 0.19
86 0.19
87 0.21
88 0.25
89 0.29
90 0.33
91 0.36
92 0.4
93 0.44
94 0.52