Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q750T0

Protein Details
Accession Q750T0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
222-252EESGSASSDKKKKKKKKDKKKDKNRSSGNDABasic
NLS Segment(s)
PositionSequence
231-246KKKKKKKKDKKKDKNR
Subcellular Location(s) nucl 21.5, mito_nucl 13, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005829  C:cytosol  
GO:0005730  C:nucleolus  
GO:0033553  C:rDNA heterochromatin  
GO:0032040  C:small-subunit processome  
GO:0008301  F:DNA binding, bending  
GO:0003690  F:double-stranded DNA binding  
GO:0000400  F:four-way junction DNA binding  
GO:0044804  P:autophagy of nucleus  
GO:0006338  P:chromatin remodeling  
GO:0006265  P:DNA topological change  
GO:2001034  P:positive regulation of double-strand break repair via nonhomologous end joining  
GO:0070550  P:rDNA chromatin condensation  
GO:0060962  P:regulation of ribosomal protein gene transcription by RNA polymerase II  
GO:0006356  P:regulation of transcription by RNA polymerase I  
GO:0001174  P:transcriptional start site selection at RNA polymerase II promoter  
KEGG ago:AGOS_AGL141W  -  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MSEPSLKLRTAKDSLVSSLFELSKAANQTASCIVDFYHVIGEDEEEKIEAFTTLTEALQRLTAATNQLHGVSTELTNPLDDDKEALPSSPAKGITKKRQERDPNAPKKPLTVFFAYSAYVRQALREERQRTGLPPLSSTEITQEISKKWKELSDSEKDKWKQAYTAELENYQREKQKYLEAKKNGIMHVYDGPNSAPVPIPEYLQSAEDSFEPLPEKRSYEEESGSASSDKKKKKKKKDKKKDKNRSSGNDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.35
3 0.33
4 0.26
5 0.27
6 0.25
7 0.2
8 0.18
9 0.15
10 0.17
11 0.19
12 0.18
13 0.17
14 0.16
15 0.19
16 0.22
17 0.23
18 0.19
19 0.16
20 0.16
21 0.16
22 0.16
23 0.14
24 0.13
25 0.11
26 0.12
27 0.12
28 0.13
29 0.12
30 0.13
31 0.12
32 0.09
33 0.09
34 0.08
35 0.09
36 0.07
37 0.06
38 0.05
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.08
48 0.08
49 0.1
50 0.12
51 0.12
52 0.13
53 0.13
54 0.13
55 0.13
56 0.12
57 0.12
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.1
64 0.1
65 0.1
66 0.09
67 0.09
68 0.1
69 0.09
70 0.12
71 0.12
72 0.11
73 0.11
74 0.12
75 0.13
76 0.14
77 0.15
78 0.15
79 0.21
80 0.29
81 0.38
82 0.48
83 0.55
84 0.57
85 0.65
86 0.72
87 0.73
88 0.76
89 0.77
90 0.76
91 0.74
92 0.74
93 0.64
94 0.59
95 0.54
96 0.46
97 0.39
98 0.31
99 0.27
100 0.24
101 0.25
102 0.21
103 0.18
104 0.16
105 0.12
106 0.12
107 0.1
108 0.09
109 0.11
110 0.14
111 0.18
112 0.26
113 0.28
114 0.27
115 0.31
116 0.31
117 0.3
118 0.33
119 0.33
120 0.25
121 0.23
122 0.24
123 0.23
124 0.23
125 0.21
126 0.17
127 0.14
128 0.14
129 0.14
130 0.14
131 0.13
132 0.18
133 0.19
134 0.18
135 0.18
136 0.19
137 0.21
138 0.25
139 0.3
140 0.34
141 0.4
142 0.41
143 0.49
144 0.48
145 0.49
146 0.47
147 0.42
148 0.35
149 0.3
150 0.35
151 0.29
152 0.32
153 0.29
154 0.29
155 0.3
156 0.3
157 0.32
158 0.28
159 0.31
160 0.27
161 0.28
162 0.27
163 0.35
164 0.41
165 0.47
166 0.53
167 0.52
168 0.55
169 0.58
170 0.6
171 0.51
172 0.44
173 0.36
174 0.29
175 0.3
176 0.27
177 0.23
178 0.19
179 0.19
180 0.18
181 0.18
182 0.16
183 0.11
184 0.1
185 0.13
186 0.13
187 0.14
188 0.13
189 0.16
190 0.16
191 0.15
192 0.16
193 0.13
194 0.13
195 0.12
196 0.14
197 0.12
198 0.13
199 0.14
200 0.14
201 0.18
202 0.19
203 0.21
204 0.21
205 0.26
206 0.29
207 0.31
208 0.32
209 0.29
210 0.31
211 0.29
212 0.29
213 0.25
214 0.23
215 0.27
216 0.33
217 0.42
218 0.48
219 0.59
220 0.68
221 0.78
222 0.87
223 0.9
224 0.94
225 0.95
226 0.97
227 0.97
228 0.98
229 0.98
230 0.97
231 0.97
232 0.96