Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0XIM3

Protein Details
Accession A0A4U0XIM3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-86GEAKERTRRRAEERRKKGGABasic
NLS Segment(s)
PositionSequence
70-85KERTRRRAEERRKKGG
Subcellular Location(s) cyto 19, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041507  UCH_C  
Pfam View protein in Pfam  
PF18031  UCH_C  
Amino Acid Sequences MVGDLRVRASEAGDTEALLAEERKRTGWQWENALRRHNFVGFVGELLRGVVKAKIAEGEGEYERWVGEAKERTRRRAEERRKKGGAAEEMDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.12
4 0.11
5 0.1
6 0.1
7 0.09
8 0.12
9 0.12
10 0.14
11 0.15
12 0.16
13 0.25
14 0.32
15 0.33
16 0.39
17 0.46
18 0.51
19 0.52
20 0.58
21 0.5
22 0.45
23 0.42
24 0.35
25 0.28
26 0.22
27 0.21
28 0.14
29 0.13
30 0.11
31 0.09
32 0.08
33 0.07
34 0.07
35 0.04
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.1
46 0.1
47 0.1
48 0.11
49 0.1
50 0.09
51 0.09
52 0.09
53 0.06
54 0.12
55 0.2
56 0.24
57 0.35
58 0.39
59 0.45
60 0.52
61 0.59
62 0.62
63 0.65
64 0.72
65 0.73
66 0.79
67 0.83
68 0.79
69 0.74
70 0.7
71 0.67
72 0.64