Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WFZ7

Protein Details
Accession A0A4U0WFZ7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-24VSRPAVSEPKKPKKPYDIKKADLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039159  SAYSD1  
IPR019387  SAYSvFN_dom  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10260  SAYSvFN  
Amino Acid Sequences MVSRPAVSEPKKPKKPYDIKKADLHLDEYIAEQDSRSPKILLQRAYTHLRSSRQFHSYLALQFVAALIGYGQPMLVVGLLWAMYVNTGKRKEGEMSAYSLFNEGVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.82
3 0.83
4 0.83
5 0.82
6 0.78
7 0.79
8 0.76
9 0.7
10 0.61
11 0.54
12 0.43
13 0.34
14 0.28
15 0.22
16 0.18
17 0.14
18 0.12
19 0.08
20 0.12
21 0.14
22 0.15
23 0.16
24 0.16
25 0.16
26 0.25
27 0.3
28 0.29
29 0.3
30 0.31
31 0.34
32 0.39
33 0.38
34 0.33
35 0.32
36 0.33
37 0.32
38 0.34
39 0.33
40 0.3
41 0.3
42 0.28
43 0.27
44 0.26
45 0.23
46 0.2
47 0.16
48 0.13
49 0.12
50 0.11
51 0.08
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.02
64 0.02
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.04
71 0.06
72 0.08
73 0.15
74 0.17
75 0.19
76 0.2
77 0.23
78 0.26
79 0.28
80 0.32
81 0.28
82 0.3
83 0.31
84 0.3
85 0.27
86 0.25
87 0.21