Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WGE9

Protein Details
Accession A0A4U0WGE9   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-63FVADSVPKRVRKRKTAGKEGLETHydrophilic
111-131SDVPLAKKRRRAERKVKLEVGBasic
NLS Segment(s)
PositionSequence
48-56KRVRKRKTA
80-84LRKRE
117-127KKRRRAERKVK
Subcellular Location(s) mito 10, cyto 9, nucl 7
Family & Domain DBs
Amino Acid Sequences IDYAAVAGLIPVKPPAARMRFARLKAAIEGGTLIGTHGKPFVADSVPKRVRKRKTAGKEGLETGADAEDDEEPGRWKPELRKREGGAKIKAEMADDGVKGESDVSAWESGSDVPLAKKRRRAERKVKLEVGVKKEDDDEDGFVKKDIGDEVVKREDGDDVEMVEESAFIKAEPGLDGAEDDCVLVSATSRLAMPTRQHASSTDFDSPTRTIQGETPPQPKMKSEFGGEYAGMSDTSGFGGMDGAPTSLYHGMEYPPLVKQEPTSEVRLVGSRERDIANYHDYAPRVHGSGEDCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.24
3 0.26
4 0.31
5 0.34
6 0.43
7 0.5
8 0.53
9 0.57
10 0.51
11 0.49
12 0.45
13 0.45
14 0.35
15 0.27
16 0.25
17 0.17
18 0.14
19 0.11
20 0.1
21 0.1
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.11
28 0.13
29 0.14
30 0.19
31 0.22
32 0.32
33 0.4
34 0.47
35 0.55
36 0.61
37 0.67
38 0.71
39 0.78
40 0.78
41 0.81
42 0.85
43 0.85
44 0.82
45 0.77
46 0.69
47 0.61
48 0.51
49 0.4
50 0.3
51 0.21
52 0.14
53 0.1
54 0.09
55 0.06
56 0.07
57 0.07
58 0.07
59 0.09
60 0.1
61 0.12
62 0.11
63 0.15
64 0.24
65 0.34
66 0.43
67 0.49
68 0.56
69 0.57
70 0.66
71 0.7
72 0.69
73 0.65
74 0.58
75 0.52
76 0.46
77 0.44
78 0.35
79 0.27
80 0.21
81 0.17
82 0.14
83 0.13
84 0.11
85 0.1
86 0.09
87 0.09
88 0.06
89 0.04
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.06
100 0.07
101 0.13
102 0.2
103 0.23
104 0.3
105 0.36
106 0.47
107 0.56
108 0.65
109 0.71
110 0.75
111 0.81
112 0.82
113 0.79
114 0.72
115 0.69
116 0.64
117 0.58
118 0.51
119 0.41
120 0.34
121 0.32
122 0.28
123 0.23
124 0.18
125 0.14
126 0.11
127 0.12
128 0.12
129 0.11
130 0.11
131 0.09
132 0.08
133 0.07
134 0.08
135 0.08
136 0.09
137 0.12
138 0.14
139 0.14
140 0.13
141 0.13
142 0.12
143 0.1
144 0.11
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.03
156 0.04
157 0.04
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.04
168 0.03
169 0.04
170 0.04
171 0.03
172 0.04
173 0.04
174 0.04
175 0.05
176 0.05
177 0.05
178 0.06
179 0.1
180 0.11
181 0.18
182 0.22
183 0.22
184 0.23
185 0.24
186 0.28
187 0.28
188 0.3
189 0.27
190 0.25
191 0.24
192 0.27
193 0.26
194 0.22
195 0.22
196 0.18
197 0.15
198 0.17
199 0.23
200 0.28
201 0.33
202 0.37
203 0.38
204 0.4
205 0.4
206 0.41
207 0.39
208 0.36
209 0.33
210 0.31
211 0.3
212 0.3
213 0.31
214 0.28
215 0.23
216 0.18
217 0.16
218 0.13
219 0.1
220 0.08
221 0.06
222 0.06
223 0.06
224 0.05
225 0.04
226 0.05
227 0.05
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.09
234 0.1
235 0.11
236 0.1
237 0.11
238 0.12
239 0.14
240 0.15
241 0.14
242 0.14
243 0.17
244 0.17
245 0.17
246 0.18
247 0.22
248 0.27
249 0.29
250 0.31
251 0.3
252 0.29
253 0.3
254 0.31
255 0.29
256 0.29
257 0.3
258 0.27
259 0.29
260 0.29
261 0.29
262 0.29
263 0.3
264 0.29
265 0.27
266 0.28
267 0.29
268 0.29
269 0.28
270 0.3
271 0.28
272 0.24
273 0.22
274 0.23