Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5FKP3

Protein Details
Accession C5FKP3    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
256-275SGCATDRRYPSRSKKPSRRRBasic
NLS Segment(s)
PositionSequence
265-275PSRSKKPSRRR
Subcellular Location(s) nucl 20, cyto 3, extr 3
Family & Domain DBs
Amino Acid Sequences MSDQPPAYRGLYPPDNSIVLSKAEGAVLPASDRCAECLHRQARYPVLELCAACRPKAVTSSALDVCPSCARPWPALRDSELCYGCFLRAPRASAITLSSLASTIEDFIERNSRFFRRYSRSTHKATQNTPAARQSVEGAGVELSPPSPSALAASTAPPATGTAVSPFDPSTQPSLQATLYSLSQAAAASANLAGLPNPPVDLGVTLHNLASAAQAASSLLSARAPPPAQNTAISAPVAAASGDTVHTTSEAEASNSGCATDRRYPSRSKKPSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.33
4 0.33
5 0.26
6 0.2
7 0.19
8 0.16
9 0.13
10 0.12
11 0.12
12 0.11
13 0.1
14 0.09
15 0.1
16 0.1
17 0.11
18 0.13
19 0.13
20 0.14
21 0.16
22 0.2
23 0.23
24 0.32
25 0.35
26 0.36
27 0.4
28 0.42
29 0.46
30 0.45
31 0.43
32 0.36
33 0.33
34 0.33
35 0.3
36 0.29
37 0.3
38 0.28
39 0.25
40 0.25
41 0.24
42 0.22
43 0.26
44 0.25
45 0.21
46 0.22
47 0.28
48 0.27
49 0.26
50 0.24
51 0.21
52 0.21
53 0.2
54 0.19
55 0.14
56 0.18
57 0.2
58 0.25
59 0.3
60 0.35
61 0.36
62 0.37
63 0.39
64 0.37
65 0.38
66 0.4
67 0.36
68 0.29
69 0.27
70 0.25
71 0.22
72 0.22
73 0.19
74 0.18
75 0.2
76 0.22
77 0.22
78 0.23
79 0.24
80 0.21
81 0.22
82 0.16
83 0.15
84 0.12
85 0.11
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.14
96 0.14
97 0.15
98 0.18
99 0.2
100 0.22
101 0.24
102 0.31
103 0.31
104 0.36
105 0.43
106 0.5
107 0.54
108 0.58
109 0.63
110 0.64
111 0.62
112 0.59
113 0.58
114 0.55
115 0.5
116 0.47
117 0.42
118 0.34
119 0.28
120 0.27
121 0.2
122 0.13
123 0.12
124 0.1
125 0.07
126 0.06
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.06
139 0.07
140 0.07
141 0.08
142 0.08
143 0.08
144 0.07
145 0.07
146 0.07
147 0.06
148 0.06
149 0.07
150 0.08
151 0.09
152 0.1
153 0.1
154 0.11
155 0.11
156 0.12
157 0.16
158 0.15
159 0.16
160 0.15
161 0.17
162 0.15
163 0.15
164 0.14
165 0.1
166 0.1
167 0.09
168 0.08
169 0.07
170 0.07
171 0.07
172 0.06
173 0.05
174 0.05
175 0.05
176 0.05
177 0.05
178 0.04
179 0.04
180 0.04
181 0.05
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.08
189 0.08
190 0.09
191 0.1
192 0.11
193 0.1
194 0.1
195 0.1
196 0.09
197 0.08
198 0.07
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.05
208 0.06
209 0.07
210 0.13
211 0.13
212 0.16
213 0.21
214 0.24
215 0.26
216 0.26
217 0.28
218 0.25
219 0.26
220 0.24
221 0.18
222 0.14
223 0.13
224 0.12
225 0.08
226 0.06
227 0.05
228 0.05
229 0.06
230 0.07
231 0.07
232 0.07
233 0.07
234 0.08
235 0.08
236 0.1
237 0.11
238 0.11
239 0.12
240 0.13
241 0.14
242 0.13
243 0.13
244 0.12
245 0.13
246 0.18
247 0.25
248 0.32
249 0.38
250 0.43
251 0.52
252 0.61
253 0.71
254 0.76
255 0.79