Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0WUH0

Protein Details
Accession A0A4U0WUH0   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-42LVLSKEQRRKRDQDARLSMLHydrophilic
147-172IRSRHFYITKWSRKKRPRKFMFGISEHydrophilic
317-342PYFPPWRYGLRDARRRRRLVNGNLDDHydrophilic
NLS Segment(s)
PositionSequence
158-165SRKKRPRK
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040151  Gfd2/YDR514C-like  
IPR012337  RNaseH-like_sf  
Amino Acid Sequences MNSRSARSTSSIATQSSHEEPVLVLSKEQRRKRDQDARLSMLKDRLYEQLDKTTTDMLHLNRYLGLQAPRKIPGISDFTAHNPSRPAPYPFLSDAVLVAVDVEGNMVSGKRVKSHHSVTEVGVSVLDTRDLVSLPPGTKACNWLEKIRSRHFYITKWSRKKRPRKFMFGISELIDIETTPDFLTSVFRIPLEPPSAGFSASVWGGIAQLLGFRRPLLEPERPTRNIVLIGHGTYNDLYNLNVLLNCDVYAAAPVVGHIDTSVMAVDEGLPASLEELATEFELSPENLHNAGNDAAYTMRVPLIMAVLRAEFGMRALPYFPPWRYGLRDARRRRRLVNGNLDDSVAQPAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.31
4 0.3
5 0.23
6 0.2
7 0.19
8 0.22
9 0.26
10 0.21
11 0.19
12 0.25
13 0.35
14 0.44
15 0.51
16 0.55
17 0.59
18 0.65
19 0.75
20 0.77
21 0.77
22 0.79
23 0.8
24 0.77
25 0.74
26 0.69
27 0.62
28 0.58
29 0.51
30 0.41
31 0.35
32 0.34
33 0.33
34 0.35
35 0.33
36 0.36
37 0.36
38 0.35
39 0.34
40 0.33
41 0.28
42 0.26
43 0.28
44 0.21
45 0.27
46 0.26
47 0.25
48 0.22
49 0.23
50 0.21
51 0.22
52 0.27
53 0.26
54 0.3
55 0.33
56 0.34
57 0.36
58 0.35
59 0.31
60 0.29
61 0.29
62 0.25
63 0.23
64 0.22
65 0.24
66 0.32
67 0.31
68 0.28
69 0.23
70 0.24
71 0.29
72 0.31
73 0.32
74 0.29
75 0.31
76 0.34
77 0.33
78 0.33
79 0.28
80 0.24
81 0.2
82 0.16
83 0.13
84 0.08
85 0.06
86 0.04
87 0.04
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.08
96 0.09
97 0.13
98 0.15
99 0.2
100 0.26
101 0.32
102 0.36
103 0.37
104 0.38
105 0.35
106 0.37
107 0.33
108 0.26
109 0.2
110 0.15
111 0.12
112 0.1
113 0.09
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.07
120 0.09
121 0.09
122 0.12
123 0.12
124 0.13
125 0.14
126 0.18
127 0.19
128 0.22
129 0.24
130 0.26
131 0.32
132 0.37
133 0.43
134 0.46
135 0.48
136 0.45
137 0.5
138 0.48
139 0.44
140 0.48
141 0.51
142 0.55
143 0.6
144 0.65
145 0.68
146 0.75
147 0.84
148 0.85
149 0.86
150 0.84
151 0.83
152 0.81
153 0.8
154 0.76
155 0.67
156 0.59
157 0.48
158 0.4
159 0.3
160 0.25
161 0.16
162 0.09
163 0.08
164 0.06
165 0.05
166 0.04
167 0.04
168 0.04
169 0.05
170 0.06
171 0.06
172 0.07
173 0.07
174 0.08
175 0.09
176 0.09
177 0.12
178 0.13
179 0.13
180 0.12
181 0.14
182 0.15
183 0.14
184 0.13
185 0.1
186 0.09
187 0.09
188 0.08
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.03
195 0.05
196 0.05
197 0.06
198 0.06
199 0.06
200 0.07
201 0.08
202 0.12
203 0.15
204 0.22
205 0.26
206 0.32
207 0.4
208 0.4
209 0.42
210 0.39
211 0.35
212 0.32
213 0.28
214 0.25
215 0.19
216 0.18
217 0.16
218 0.15
219 0.15
220 0.12
221 0.12
222 0.09
223 0.08
224 0.07
225 0.07
226 0.07
227 0.07
228 0.07
229 0.08
230 0.07
231 0.07
232 0.07
233 0.07
234 0.06
235 0.06
236 0.06
237 0.06
238 0.05
239 0.05
240 0.05
241 0.06
242 0.06
243 0.06
244 0.05
245 0.05
246 0.05
247 0.05
248 0.06
249 0.04
250 0.04
251 0.04
252 0.05
253 0.05
254 0.05
255 0.04
256 0.04
257 0.04
258 0.05
259 0.05
260 0.05
261 0.04
262 0.05
263 0.06
264 0.06
265 0.07
266 0.06
267 0.06
268 0.08
269 0.08
270 0.09
271 0.1
272 0.11
273 0.12
274 0.12
275 0.12
276 0.13
277 0.13
278 0.12
279 0.1
280 0.09
281 0.09
282 0.09
283 0.09
284 0.08
285 0.07
286 0.07
287 0.07
288 0.07
289 0.1
290 0.1
291 0.1
292 0.1
293 0.1
294 0.1
295 0.1
296 0.1
297 0.07
298 0.07
299 0.1
300 0.09
301 0.1
302 0.11
303 0.13
304 0.17
305 0.24
306 0.24
307 0.25
308 0.27
309 0.31
310 0.36
311 0.44
312 0.49
313 0.53
314 0.63
315 0.7
316 0.79
317 0.84
318 0.84
319 0.81
320 0.81
321 0.81
322 0.81
323 0.81
324 0.78
325 0.73
326 0.68
327 0.63
328 0.52
329 0.43