Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0XAH8

Protein Details
Accession A0A4U0XAH8    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
268-289VESLQRERRKREEQKRAEERALBasic
NLS Segment(s)
PositionSequence
273-290RERRKREEQKRAEERALK
430-433RKRR
Subcellular Location(s) nucl 17, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044059  Csn1/TTC4_wheel  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
Gene Ontology GO:0051879  F:Hsp90 protein binding  
Pfam View protein in Pfam  
PF18972  Wheel  
CDD cd21381  CTWD_TTC4  
Amino Acid Sequences MAQALSKDLDKSLDLKGGPSESALPASSSRLLDGVVPQDVPFPMKGDIQTMTCPSQPSVALPPAMASVKQYTADEVLKLMNRTPLFMTTLDETDGEGGDNLELEAIRALAYEGTRAEIAGNFKEQGNDMAKVKRWVDAKEFYSKALAALKAPLKPQDPDEGPADMDVVEVDEEAEGKKELQIEEACFVNRALCNLELKNYRSCNLDCALALRINSSNVKAWYRSASACLALDKIPEAEDSCARGLEVDPDNAALRLLHVKVGKRKEYVESLQRERRKREEQKRAEERALKMALKGRNILTRQSGQPPEMEDATIKLSDPLDASSTLSFPAILLYPLQLQSDFIKAFQETESVGQHLTYIFPLPWDEKNEYTPESVECYMETVSGGLIKAGKKMSLLKILNSGKVEVVDGMLKINVVPKAKAAEWIEDFKRKRRPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.24
4 0.24
5 0.23
6 0.22
7 0.21
8 0.17
9 0.19
10 0.18
11 0.17
12 0.16
13 0.19
14 0.21
15 0.19
16 0.18
17 0.16
18 0.16
19 0.16
20 0.18
21 0.18
22 0.16
23 0.16
24 0.15
25 0.18
26 0.18
27 0.19
28 0.16
29 0.15
30 0.16
31 0.18
32 0.18
33 0.19
34 0.2
35 0.2
36 0.23
37 0.24
38 0.25
39 0.24
40 0.25
41 0.23
42 0.24
43 0.22
44 0.23
45 0.25
46 0.25
47 0.24
48 0.22
49 0.22
50 0.21
51 0.22
52 0.19
53 0.15
54 0.15
55 0.16
56 0.18
57 0.17
58 0.16
59 0.19
60 0.2
61 0.18
62 0.16
63 0.17
64 0.19
65 0.2
66 0.2
67 0.22
68 0.21
69 0.23
70 0.23
71 0.22
72 0.22
73 0.21
74 0.22
75 0.18
76 0.19
77 0.18
78 0.16
79 0.14
80 0.12
81 0.12
82 0.09
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.06
98 0.07
99 0.07
100 0.08
101 0.08
102 0.08
103 0.09
104 0.1
105 0.12
106 0.13
107 0.14
108 0.14
109 0.14
110 0.15
111 0.15
112 0.17
113 0.18
114 0.19
115 0.2
116 0.23
117 0.25
118 0.29
119 0.29
120 0.29
121 0.29
122 0.29
123 0.33
124 0.35
125 0.36
126 0.39
127 0.39
128 0.35
129 0.34
130 0.31
131 0.26
132 0.23
133 0.21
134 0.13
135 0.18
136 0.2
137 0.21
138 0.22
139 0.25
140 0.23
141 0.24
142 0.25
143 0.27
144 0.26
145 0.26
146 0.27
147 0.24
148 0.22
149 0.2
150 0.19
151 0.11
152 0.09
153 0.06
154 0.05
155 0.04
156 0.03
157 0.03
158 0.03
159 0.03
160 0.04
161 0.04
162 0.04
163 0.05
164 0.06
165 0.08
166 0.08
167 0.11
168 0.13
169 0.13
170 0.14
171 0.15
172 0.14
173 0.13
174 0.12
175 0.11
176 0.1
177 0.1
178 0.1
179 0.1
180 0.13
181 0.13
182 0.18
183 0.19
184 0.21
185 0.26
186 0.25
187 0.26
188 0.27
189 0.27
190 0.25
191 0.22
192 0.2
193 0.15
194 0.15
195 0.15
196 0.13
197 0.13
198 0.11
199 0.11
200 0.11
201 0.12
202 0.12
203 0.12
204 0.13
205 0.14
206 0.14
207 0.15
208 0.15
209 0.17
210 0.16
211 0.15
212 0.14
213 0.14
214 0.14
215 0.13
216 0.12
217 0.1
218 0.1
219 0.08
220 0.07
221 0.07
222 0.07
223 0.07
224 0.08
225 0.08
226 0.1
227 0.1
228 0.1
229 0.09
230 0.09
231 0.08
232 0.12
233 0.13
234 0.11
235 0.11
236 0.11
237 0.12
238 0.12
239 0.11
240 0.06
241 0.06
242 0.08
243 0.08
244 0.11
245 0.13
246 0.17
247 0.24
248 0.31
249 0.35
250 0.34
251 0.35
252 0.36
253 0.39
254 0.4
255 0.42
256 0.42
257 0.45
258 0.51
259 0.57
260 0.59
261 0.59
262 0.62
263 0.64
264 0.69
265 0.72
266 0.75
267 0.78
268 0.83
269 0.87
270 0.84
271 0.8
272 0.75
273 0.66
274 0.62
275 0.56
276 0.45
277 0.38
278 0.39
279 0.36
280 0.32
281 0.33
282 0.28
283 0.31
284 0.32
285 0.33
286 0.31
287 0.31
288 0.33
289 0.37
290 0.37
291 0.31
292 0.32
293 0.31
294 0.29
295 0.26
296 0.23
297 0.15
298 0.14
299 0.15
300 0.14
301 0.12
302 0.1
303 0.1
304 0.1
305 0.11
306 0.1
307 0.1
308 0.1
309 0.12
310 0.11
311 0.11
312 0.1
313 0.1
314 0.09
315 0.07
316 0.08
317 0.07
318 0.07
319 0.07
320 0.07
321 0.09
322 0.1
323 0.11
324 0.1
325 0.11
326 0.12
327 0.16
328 0.16
329 0.14
330 0.15
331 0.15
332 0.16
333 0.15
334 0.15
335 0.11
336 0.13
337 0.14
338 0.13
339 0.13
340 0.12
341 0.12
342 0.11
343 0.11
344 0.09
345 0.09
346 0.08
347 0.09
348 0.12
349 0.14
350 0.18
351 0.22
352 0.25
353 0.26
354 0.29
355 0.32
356 0.32
357 0.31
358 0.28
359 0.24
360 0.25
361 0.24
362 0.21
363 0.17
364 0.17
365 0.16
366 0.14
367 0.13
368 0.08
369 0.08
370 0.09
371 0.09
372 0.08
373 0.11
374 0.12
375 0.16
376 0.17
377 0.17
378 0.18
379 0.25
380 0.29
381 0.36
382 0.37
383 0.35
384 0.43
385 0.46
386 0.48
387 0.43
388 0.39
389 0.3
390 0.29
391 0.28
392 0.18
393 0.16
394 0.13
395 0.12
396 0.12
397 0.11
398 0.1
399 0.1
400 0.14
401 0.17
402 0.18
403 0.19
404 0.21
405 0.26
406 0.26
407 0.33
408 0.31
409 0.34
410 0.36
411 0.43
412 0.46
413 0.5
414 0.54
415 0.54