Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5NFY3

Protein Details
Accession A0A4V5NFY3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
45-64TSVRRFYHRIRNGRPPPQGSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 6, mito_nucl 6, cyto 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSGDDGGDAATRTMPDNLDGLALTRRERLLLVALSYAWVSPVIFTSVRRFYHRIRNGRPPPQGSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.11
5 0.1
6 0.1
7 0.09
8 0.11
9 0.11
10 0.11
11 0.12
12 0.12
13 0.12
14 0.12
15 0.12
16 0.12
17 0.11
18 0.11
19 0.09
20 0.09
21 0.09
22 0.08
23 0.07
24 0.05
25 0.04
26 0.04
27 0.04
28 0.05
29 0.07
30 0.08
31 0.09
32 0.15
33 0.21
34 0.24
35 0.29
36 0.32
37 0.35
38 0.46
39 0.54
40 0.59
41 0.6
42 0.69
43 0.73
44 0.79
45 0.82