Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0W7H0

Protein Details
Accession A0A4U0W7H0    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
126-145ADSQPKRKRGRPTNEEKQARBasic
NLS Segment(s)
PositionSequence
131-136KRKRGR
Subcellular Location(s) nucl 19, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MDLPPERPWNGYEKVELLTEIIKAANVSSDFLMRIIGEAQISPNWAEIPLPAGRSLRSSQNIYQELLAASSPQSRSRPAKAQIPASETSRKRPLSLAFDAPTLTPTNRTIQPRPTASGLSDPAYSADSQPKRKRGRPTNEEKQARAAAAAAAAAAGAVRREDYAPPMGGPPSPLASGLEFATRGVAPDHASADAAIPALLSAAETGSETSTGQKKRGRPSKADIAARNAVATAAAALDETALHGSAGIVVRDSQDTMTAPGPSAPEEADTHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.21
5 0.17
6 0.15
7 0.13
8 0.11
9 0.09
10 0.09
11 0.09
12 0.11
13 0.1
14 0.12
15 0.12
16 0.13
17 0.13
18 0.13
19 0.13
20 0.09
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.1
27 0.1
28 0.11
29 0.11
30 0.1
31 0.1
32 0.1
33 0.09
34 0.08
35 0.11
36 0.11
37 0.12
38 0.14
39 0.14
40 0.15
41 0.18
42 0.21
43 0.24
44 0.27
45 0.31
46 0.33
47 0.4
48 0.42
49 0.39
50 0.37
51 0.31
52 0.26
53 0.22
54 0.18
55 0.1
56 0.09
57 0.12
58 0.13
59 0.16
60 0.17
61 0.23
62 0.28
63 0.33
64 0.4
65 0.41
66 0.47
67 0.48
68 0.53
69 0.5
70 0.5
71 0.46
72 0.42
73 0.47
74 0.4
75 0.42
76 0.43
77 0.4
78 0.37
79 0.38
80 0.39
81 0.37
82 0.4
83 0.39
84 0.31
85 0.31
86 0.3
87 0.27
88 0.23
89 0.18
90 0.14
91 0.11
92 0.12
93 0.16
94 0.21
95 0.26
96 0.28
97 0.32
98 0.38
99 0.38
100 0.39
101 0.36
102 0.32
103 0.28
104 0.28
105 0.23
106 0.18
107 0.16
108 0.14
109 0.12
110 0.12
111 0.12
112 0.1
113 0.16
114 0.19
115 0.28
116 0.33
117 0.41
118 0.47
119 0.53
120 0.62
121 0.65
122 0.71
123 0.72
124 0.76
125 0.78
126 0.81
127 0.78
128 0.68
129 0.62
130 0.53
131 0.43
132 0.33
133 0.23
134 0.13
135 0.1
136 0.09
137 0.05
138 0.03
139 0.03
140 0.03
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.04
147 0.05
148 0.06
149 0.08
150 0.11
151 0.11
152 0.11
153 0.12
154 0.12
155 0.11
156 0.12
157 0.11
158 0.1
159 0.1
160 0.1
161 0.09
162 0.09
163 0.1
164 0.1
165 0.09
166 0.08
167 0.08
168 0.09
169 0.08
170 0.08
171 0.08
172 0.08
173 0.09
174 0.1
175 0.11
176 0.1
177 0.1
178 0.09
179 0.09
180 0.09
181 0.07
182 0.06
183 0.05
184 0.04
185 0.04
186 0.04
187 0.03
188 0.03
189 0.03
190 0.03
191 0.04
192 0.04
193 0.05
194 0.05
195 0.06
196 0.1
197 0.17
198 0.19
199 0.25
200 0.3
201 0.37
202 0.47
203 0.56
204 0.59
205 0.58
206 0.64
207 0.69
208 0.72
209 0.73
210 0.66
211 0.64
212 0.6
213 0.54
214 0.46
215 0.35
216 0.26
217 0.19
218 0.15
219 0.08
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.08
233 0.1
234 0.09
235 0.09
236 0.1
237 0.12
238 0.13
239 0.14
240 0.11
241 0.11
242 0.12
243 0.15
244 0.17
245 0.16
246 0.15
247 0.16
248 0.17
249 0.17
250 0.17
251 0.15
252 0.15